LOCUS CR456961 861 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0119D for gene SSR1, signal sequence receptor, alpha (translocon-associated protein alpha); complete cds, incl. stopcodon. ACCESSION CR456961 VERSION CR456961.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 861) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 861) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0119D, ORFNo 1430 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0119D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC007710 we found amino acid exchange(s) at position (first base of changed triplet): 856(glu->asp) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..861 /db_xref="H-InvDB:HIT000267811" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0119D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..861 /codon_start=1 /gene="SSR1" /db_xref="GOA:P43307" /db_xref="H-InvDB:HIT000267811.12" /db_xref="HGNC:HGNC:11323" /db_xref="InterPro:IPR005595" /db_xref="UniProtKB/Swiss-Prot:P43307" /protein_id="CAG33242.1" /translation="MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVED SIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFVKGEDFPANNIVK FLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIP AEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLG LLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKR AQKRSVGSDD" BASE COUNT 261 a 171 c 200 g 229 t ORIGIN 1 atgagactcc tcccccgctt gctgctgctt ctcttactcg tgttccctgc cactgtcttg 61 ttccgaggcg gccccagagg cttgttagca gtggcacaag atcttacaga ggatgaagaa 121 acagtagaag attccataat tgaggatgaa gatgatgaag ccgaggtaga agaagatgaa 181 cccacagatt tggtagaaga taaagaggaa gaagatgtgt ctggtgaacc tgaagcttca 241 ccgagtgcag atacaactat actgtttgta aaaggagaag attttccagc aaataacatt 301 gtgaagttcc tggtaggctt taccaacaag ggtacagaag attttattgt tgaatcctta 361 gatgcctcat tccgttatcc tcaggactac cagttttata tccagaattt cacagctctt 421 cctctgaaca ctgtagtgcc accccagaga caggcaactt ttgagtactc tttcattcct 481 gcagagccca tgggcggacg accatttggt ttggtcatca atctgaacta caaagatttg 541 aacggcaatg tattccaaga tgcagtcttc aatcaaacag ttacagttat tgaaagagag 601 gatgggttag atggagaaac aatctttatg tatatgttcc ttgctggtct tgggcttctg 661 gttattgttg gccttcatca actcctagaa tctagaaagc gtaagagacc catacagaaa 721 gtagaaatgg gtacatcaag tcagaatgat gttgacatga gttggattcc tcaggaaaca 781 ttgaatcaaa tcaataaagc ttcaccaaga aggttgccca ggaaacgggc acagaagaga 841 tcagtgggat ctgatgatta a //