LOCUS       CR456961                 861 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B0119D for
            gene SSR1, signal sequence receptor, alpha (translocon-associated
            protein alpha); complete cds, incl. stopcodon.
ACCESSION   CR456961
VERSION     CR456961.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 861)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 861)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B0119D, ORFNo 1430
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0119D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence BC007710 we found amino acid
            exchange(s) at position (first base of changed triplet):
            856(glu->asp)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..861
                     /db_xref="H-InvDB:HIT000267811"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B0119D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..861
                     /codon_start=1
                     /gene="SSR1"
                     /db_xref="GOA:P43307"
                     /db_xref="H-InvDB:HIT000267811.12"
                     /db_xref="HGNC:HGNC:11323"
                     /db_xref="InterPro:IPR005595"
                     /db_xref="UniProtKB/Swiss-Prot:P43307"
                     /protein_id="CAG33242.1"
                     /translation="MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVED
                     SIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFVKGEDFPANNIVK
                     FLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIP
                     AEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLG
                     LLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKR
                     AQKRSVGSDD"
BASE COUNT          261 a          171 c          200 g          229 t
ORIGIN      
        1 atgagactcc tcccccgctt gctgctgctt ctcttactcg tgttccctgc cactgtcttg
       61 ttccgaggcg gccccagagg cttgttagca gtggcacaag atcttacaga ggatgaagaa
      121 acagtagaag attccataat tgaggatgaa gatgatgaag ccgaggtaga agaagatgaa
      181 cccacagatt tggtagaaga taaagaggaa gaagatgtgt ctggtgaacc tgaagcttca
      241 ccgagtgcag atacaactat actgtttgta aaaggagaag attttccagc aaataacatt
      301 gtgaagttcc tggtaggctt taccaacaag ggtacagaag attttattgt tgaatcctta
      361 gatgcctcat tccgttatcc tcaggactac cagttttata tccagaattt cacagctctt
      421 cctctgaaca ctgtagtgcc accccagaga caggcaactt ttgagtactc tttcattcct
      481 gcagagccca tgggcggacg accatttggt ttggtcatca atctgaacta caaagatttg
      541 aacggcaatg tattccaaga tgcagtcttc aatcaaacag ttacagttat tgaaagagag
      601 gatgggttag atggagaaac aatctttatg tatatgttcc ttgctggtct tgggcttctg
      661 gttattgttg gccttcatca actcctagaa tctagaaagc gtaagagacc catacagaaa
      721 gtagaaatgg gtacatcaag tcagaatgat gttgacatga gttggattcc tcaggaaaca
      781 ttgaatcaaa tcaataaagc ttcaccaaga aggttgccca ggaaacgggc acagaagaga
      841 tcagtgggat ctgatgatta a
//