LOCUS CR456952 846 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C0319D for gene PLAUR, plasminogen activator, urokinase receptor; complete cds, incl. stopcodon. ACCESSION CR456952 VERSION CR456952.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 846) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 846) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C0319D, ORFNo 1390 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0319D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence X74039 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..846 /db_xref="H-InvDB:HIT000267802" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C0319D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..846 /codon_start=1 /gene="PLAUR" /db_xref="GOA:Q03405" /db_xref="H-InvDB:HIT000267802.12" /db_xref="HGNC:HGNC:9053" /db_xref="InterPro:IPR016054" /db_xref="InterPro:IPR018363" /db_xref="InterPro:IPR033084" /db_xref="PDB:1YWH" /db_xref="PDB:2FD6" /db_xref="PDB:2I9B" /db_xref="PDB:3BT1" /db_xref="PDB:3BT2" /db_xref="PDB:3U73" /db_xref="PDB:3U74" /db_xref="PDB:4K24" /db_xref="PDB:4QTI" /db_xref="UniProtKB/Swiss-Prot:Q03405" /protein_id="CAG33233.1" /translation="MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQD LCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGN SGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRP KDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYS CKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHERSLWGSWLPCKSTTALRPPCCEEA QATHV" BASE COUNT 193 a 246 c 243 g 164 t ORIGIN 1 atgggtcacc cgccgctgct gccgctgctg ctgctgctcc acacctgcgt cccagcctct 61 tggggcctgc ggtgcatgca gtgtaagacc aacggggatt gccgtgtgga agagtgcgcc 121 ctgggacagg acctctgcag gaccacgatc gtgcgcttgt gggaagaagg agaagagctg 181 gagctggtgg agaaaagctg tacccattca gagaagacca acaggaccct gagctatcgg 241 actggcttga agatcaccag ccttaccgag gttgtgtgtg ggttagactt gtgcaaccag 301 ggcaactctg gccgggctgt cacctattcc cgaagccgtt acctcgaatg catttcctgt 361 ggctcatcag acatgagctg tgagaggggc cggcaccaga gcctgcagtg ccgcagccct 421 gaagaacagt gcctggatgt ggtgacccac tggatccagg aaggtgaaga agggcgtcca 481 aaggatgacc gccacctccg tggctgtggc taccttcccg gctgcccggg ctccaatggt 541 ttccacaaca acgacacctt ccacttcctg aaatgctgca acaccaccaa atgcaacgag 601 ggcccaatcc tggagcttga aaatctgccg cagaatggcc gccagtgtta cagctgcaag 661 gggaacagca cccatggatg ctcctctgaa gagactttcc tcattgactg ccgaggcccc 721 atgaatcaat gtctggtagc caccggcact cacgaacgct cactctgggg aagctggttg 781 ccatgtaaaa gtactactgc cctgagacca ccatgctgtg aggaagccca agctactcat 841 gtttaa //