LOCUS       CR456952                 846 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C0319D for
            gene PLAUR, plasminogen activator, urokinase receptor; complete
            cds, incl. stopcodon.
ACCESSION   CR456952
VERSION     CR456952.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 846)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 846)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C0319D, ORFNo 1390
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0319D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence X74039 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..846
                     /db_xref="H-InvDB:HIT000267802"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C0319D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..846
                     /codon_start=1
                     /gene="PLAUR"
                     /db_xref="GOA:Q03405"
                     /db_xref="H-InvDB:HIT000267802.12"
                     /db_xref="HGNC:HGNC:9053"
                     /db_xref="InterPro:IPR016054"
                     /db_xref="InterPro:IPR018363"
                     /db_xref="InterPro:IPR033084"
                     /db_xref="PDB:1YWH"
                     /db_xref="PDB:2FD6"
                     /db_xref="PDB:2I9B"
                     /db_xref="PDB:3BT1"
                     /db_xref="PDB:3BT2"
                     /db_xref="PDB:3U73"
                     /db_xref="PDB:3U74"
                     /db_xref="PDB:4K24"
                     /db_xref="PDB:4QTI"
                     /db_xref="UniProtKB/Swiss-Prot:Q03405"
                     /protein_id="CAG33233.1"
                     /translation="MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQD
                     LCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGN
                     SGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRP
                     KDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYS
                     CKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHERSLWGSWLPCKSTTALRPPCCEEA
                     QATHV"
BASE COUNT          193 a          246 c          243 g          164 t
ORIGIN      
        1 atgggtcacc cgccgctgct gccgctgctg ctgctgctcc acacctgcgt cccagcctct
       61 tggggcctgc ggtgcatgca gtgtaagacc aacggggatt gccgtgtgga agagtgcgcc
      121 ctgggacagg acctctgcag gaccacgatc gtgcgcttgt gggaagaagg agaagagctg
      181 gagctggtgg agaaaagctg tacccattca gagaagacca acaggaccct gagctatcgg
      241 actggcttga agatcaccag ccttaccgag gttgtgtgtg ggttagactt gtgcaaccag
      301 ggcaactctg gccgggctgt cacctattcc cgaagccgtt acctcgaatg catttcctgt
      361 ggctcatcag acatgagctg tgagaggggc cggcaccaga gcctgcagtg ccgcagccct
      421 gaagaacagt gcctggatgt ggtgacccac tggatccagg aaggtgaaga agggcgtcca
      481 aaggatgacc gccacctccg tggctgtggc taccttcccg gctgcccggg ctccaatggt
      541 ttccacaaca acgacacctt ccacttcctg aaatgctgca acaccaccaa atgcaacgag
      601 ggcccaatcc tggagcttga aaatctgccg cagaatggcc gccagtgtta cagctgcaag
      661 gggaacagca cccatggatg ctcctctgaa gagactttcc tcattgactg ccgaggcccc
      721 atgaatcaat gtctggtagc caccggcact cacgaacgct cactctgggg aagctggttg
      781 ccatgtaaaa gtactactgc cctgagacca ccatgctgtg aggaagccca agctactcat
      841 gtttaa
//