LOCUS CR456947 1239 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E1218D for gene CTSD, cathepsin D (lysosomal aspartyl protease); complete cds, incl. stopcodon. ACCESSION CR456947 VERSION CR456947.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1239) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1239) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E1218D, ORFNo 1349 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E1218D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_001909 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1239 /db_xref="H-InvDB:HIT000267797" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E1218D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1239 /codon_start=1 /gene="CTSD" /db_xref="GOA:P07339" /db_xref="H-InvDB:HIT000267797.12" /db_xref="HGNC:HGNC:2529" /db_xref="InterPro:IPR001461" /db_xref="InterPro:IPR001969" /db_xref="InterPro:IPR012848" /db_xref="InterPro:IPR021109" /db_xref="InterPro:IPR033121" /db_xref="InterPro:IPR033144" /db_xref="PDB:1LYA" /db_xref="PDB:1LYB" /db_xref="PDB:1LYW" /db_xref="PDB:4OBZ" /db_xref="PDB:4OC6" /db_xref="PDB:4OD9" /db_xref="UniProtKB/Swiss-Prot:P07339" /protein_id="CAG33228.1" /translation="MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVE DLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSN LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPC QSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNL MQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQ VEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVST LPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGR YYTVFDRDNNRVGFAEAARL" BASE COUNT 237 a 403 c 366 g 233 t ORIGIN 1 atgcagccct ccagccttct gccgctcgcc ctctgcctgc tggctgcacc cgcctccgcg 61 ctcgtcagga tcccgctgca caagttcacg tccatccgcc ggaccatgtc ggaggttggg 121 ggctctgtgg aggacctgat tgccaaaggc cccgtctcaa agtactccca ggcggtgcca 181 gccgtgaccg aggggcccat tcccgaggtg ctcaagaact acatggacgc ccagtactac 241 ggggagattg gcatcgggac gcccccccag tgcttcacag tcgtcttcga cacgggctcc 301 tccaacctgt gggtcccctc catccactgc aaactgctgg acatcgcttg ctggatccac 361 cacaagtaca acagcgacaa gtccagcacc tacgtgaaga atggtacctc gtttgacatc 421 cactatggct cgggcagcct ctccgggtac ctgagccagg acactgtgtc ggtgccctgc 481 cagtcagcgt cgtcagcctc tgccctgggc ggtgtcaaag tggagaggca ggtctttggg 541 gaggccacca agcagccagg catcaccttc atcgcagcca agttcgatgg catcctgggc 601 atggcctacc cccgcatctc cgtcaacaac gtgctgcccg tcttcgacaa cctgatgcag 661 cagaagctgg tggaccagaa catcttctcc ttctacctga gcagggaccc agatgcgcag 721 cctgggggtg agctgatgct gggtggcaca gactccaagt attacaaggg ttctctgtcc 781 tacctgaatg tcacccgcaa ggcctactgg caggtccacc tggaccaggt ggaggtggcc 841 agcgggctga ccctgtgcaa ggagggctgt gaggccattg tggacacagg cacttccctc 901 atggtgggcc cggtggatga ggtgcgcgag ctgcagaagg ccatcggggc cgtgccgctg 961 attcagggcg agtacatgat cccctgtgag aaggtgtcca ccctgcccgc gatcacactg 1021 aagctgggag gcaaaggcta caagctgtcc ccagaggact acacgctcaa ggtgtcgcag 1081 gccgggaaga ccctctgcct gagcggcttc atgggcatgg acatcccgcc acccagcggg 1141 ccactctgga tcctgggcga cgtcttcatc ggccgctact acactgtgtt tgaccgtgac 1201 aacaacaggg tgggcttcgc cgaggctgcc cgcctttaa //