LOCUS       CR456931                 342 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B0116D for
            gene TCTEL1, t-complex-associated-testis-expressed 1-like 1;
            complete cds, incl. stopcodon.
ACCESSION   CR456931
VERSION     CR456931.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 342)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 342)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B0116D, ORFNo 1306
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0116D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_006519 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..342
                     /db_xref="H-InvDB:HIT000267781"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B0116D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..342
                     /codon_start=1
                     /gene="TCTEL1"
                     /db_xref="GOA:P63172"
                     /db_xref="H-InvDB:HIT000267781.12"
                     /db_xref="HGNC:HGNC:11697"
                     /db_xref="InterPro:IPR005334"
                     /db_xref="InterPro:IPR038586"
                     /db_xref="PDB:5JPW"
                     /db_xref="UniProtKB/Swiss-Prot:P63172"
                     /protein_id="CAG33212.1"
                     /translation="MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTT
                     NVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTM
                     YCIVSAFGLSI"
BASE COUNT          108 a           68 c           86 g           80 t
ORIGIN      
        1 atggaagact accaggctgc ggaggagact gcttttgttg ttgatgaagt gagcaacatt
       61 gtaaaagagg ctatagaaag cgcaattggt ggtaacgctt atcaacacag caaagtgaac
      121 cagtggacca caaatgtagt agaacaaact ttaagccaac tcaccaagct gggaaaacca
      181 tttaaataca tcgtgacctg tgtaattatg cagaagaatg gagctggatt acacacagca
      241 agttcctgct tctgggacag ctctactgac gggagctgca ctgtgcgatg ggagaataag
      301 accatgtact gcatcgtcag tgccttcgga ctgtctattt aa
//