LOCUS CR456906 1059 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F0211D for gene EIF3S3, eukaryotic translation initiation factor 3, subunit 3 gamma, 40kDa; complete cds, incl. stopcodon. ACCESSION CR456906 VERSION CR456906.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1059) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1059) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F0211D, ORFNo 1254 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0211D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_003756 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1059 /db_xref="H-InvDB:HIT000267756" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F0211D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1059 /codon_start=1 /gene="EIF3S3" /db_xref="GOA:Q6IB98" /db_xref="H-InvDB:HIT000267756.13" /db_xref="InterPro:IPR000555" /db_xref="InterPro:IPR027524" /db_xref="InterPro:IPR037518" /db_xref="UniProtKB/TrEMBL:Q6IB98" /protein_id="CAG33187.1" /translation="MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGL VVLKIIKHYQEEGQGTEVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQME MMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQG SLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWEL EKKSAVADKHELLSLASSNHLGKNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQ YQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFT AQNLGKLFMAQALQEYNN" BASE COUNT 329 a 247 c 241 g 242 t ORIGIN 1 atggcgtccc gcaaggaagg taccggctct actgccacct cttccagctc caccgccggc 61 gcagcaggga aaggcaaagg caaaggcggc tcgggagatt cagccgtgaa gcaagtgcag 121 atagatggcc ttgtggtatt aaagataatc aaacattatc aagaagaagg acaaggaact 181 gaagttgttc aaggagtgct tttgggtctg gttgtagaag atcggcttga aattaccaac 241 tgctttcctt tccctcagca cacagaggat gatgctgact ttgatgaagt ccaatatcag 301 atggaaatga tgcggagcct tcgccatgta aacattgatc atcttcacgt gggctggtat 361 cagtccacat actatggctc attcgttacc cgggcactcc tggactctca gtttagttac 421 cagcatgcca ttgaagaatc tgtcgttctc atttatgatc ccataaaaac tgcccaagga 481 tctctctcac taaaggcata cagactgact cctaaactga tggaagtttg taaagaaaag 541 gatttttccc ctgaagcatt gaaaaaagca aatatcacct ttgagtacat gtttgaagaa 601 gtgccgattg taattaaaaa ttcacatctg atcaatgtcc taatgtggga acttgaaaag 661 aagtcagctg ttgcagataa acatgaattg ctcagccttg ccagcagcaa tcatttgggg 721 aagaatctac agttgctgat ggacagagtg gatgaaatga gccaagatat agttaaatac 781 aacacataca tgaggaatac tagtaaacaa cagcagcaga aacatcagta tcagcagcgt 841 cgccagcagg agaatatgca gcgccagagc cgaggagaac ccccgctccc tgaggaggac 901 ctgtccaaac tcttcaaacc accacagccg cctgccagga tggactcgct gctcattgca 961 ggccagataa acacttactg ccagaacatc aaggagttca ctgcccaaaa cttaggcaag 1021 ctcttcatgg cccaggctct tcaagaatac aacaattaa //