LOCUS       CR456906                1059 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F0211D for
            gene EIF3S3, eukaryotic translation initiation factor 3, subunit 3
            gamma, 40kDa; complete cds, incl. stopcodon.
ACCESSION   CR456906
VERSION     CR456906.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1059)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1059)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F0211D, ORFNo 1254
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0211D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_003756 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1059
                     /db_xref="H-InvDB:HIT000267756"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F0211D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1059
                     /codon_start=1
                     /gene="EIF3S3"
                     /db_xref="GOA:Q6IB98"
                     /db_xref="H-InvDB:HIT000267756.13"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR027524"
                     /db_xref="InterPro:IPR037518"
                     /db_xref="UniProtKB/TrEMBL:Q6IB98"
                     /protein_id="CAG33187.1"
                     /translation="MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGL
                     VVLKIIKHYQEEGQGTEVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQME
                     MMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQG
                     SLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWEL
                     EKKSAVADKHELLSLASSNHLGKNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQ
                     YQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFT
                     AQNLGKLFMAQALQEYNN"
BASE COUNT          329 a          247 c          241 g          242 t
ORIGIN      
        1 atggcgtccc gcaaggaagg taccggctct actgccacct cttccagctc caccgccggc
       61 gcagcaggga aaggcaaagg caaaggcggc tcgggagatt cagccgtgaa gcaagtgcag
      121 atagatggcc ttgtggtatt aaagataatc aaacattatc aagaagaagg acaaggaact
      181 gaagttgttc aaggagtgct tttgggtctg gttgtagaag atcggcttga aattaccaac
      241 tgctttcctt tccctcagca cacagaggat gatgctgact ttgatgaagt ccaatatcag
      301 atggaaatga tgcggagcct tcgccatgta aacattgatc atcttcacgt gggctggtat
      361 cagtccacat actatggctc attcgttacc cgggcactcc tggactctca gtttagttac
      421 cagcatgcca ttgaagaatc tgtcgttctc atttatgatc ccataaaaac tgcccaagga
      481 tctctctcac taaaggcata cagactgact cctaaactga tggaagtttg taaagaaaag
      541 gatttttccc ctgaagcatt gaaaaaagca aatatcacct ttgagtacat gtttgaagaa
      601 gtgccgattg taattaaaaa ttcacatctg atcaatgtcc taatgtggga acttgaaaag
      661 aagtcagctg ttgcagataa acatgaattg ctcagccttg ccagcagcaa tcatttgggg
      721 aagaatctac agttgctgat ggacagagtg gatgaaatga gccaagatat agttaaatac
      781 aacacataca tgaggaatac tagtaaacaa cagcagcaga aacatcagta tcagcagcgt
      841 cgccagcagg agaatatgca gcgccagagc cgaggagaac ccccgctccc tgaggaggac
      901 ctgtccaaac tcttcaaacc accacagccg cctgccagga tggactcgct gctcattgca
      961 ggccagataa acacttactg ccagaacatc aaggagttca ctgcccaaaa cttaggcaag
     1021 ctcttcatgg cccaggctct tcaagaatac aacaattaa
//