LOCUS CR456898 489 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A047D for gene SNX3, sorting nexin 3; complete cds, incl. stopcodon. ACCESSION CR456898 VERSION CR456898.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 489) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 489) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A047D, ORFNo 1236 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A047D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_003795 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..489 /db_xref="H-InvDB:HIT000267748" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A047D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..489 /codon_start=1 /gene="SNX3" /db_xref="GOA:O60493" /db_xref="H-InvDB:HIT000267748.12" /db_xref="HGNC:HGNC:11174" /db_xref="InterPro:IPR001683" /db_xref="InterPro:IPR036871" /db_xref="InterPro:IPR042137" /db_xref="PDB:2MXC" /db_xref="PDB:2YPS" /db_xref="PDB:5F0J" /db_xref="PDB:5F0L" /db_xref="PDB:5F0M" /db_xref="PDB:5F0P" /db_xref="UniProtKB/Swiss-Prot:O60493" /protein_id="CAG33179.1" /translation="MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRG RFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLP FRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIR HA" BASE COUNT 148 a 108 c 121 g 112 t ORIGIN 1 atggcggaga ccgtggctga cacccggcgg ctgatcacca agccgcagaa cctgaatgac 61 gcctacggac cccccagcaa cttcctcgag atcgatgtga gcaacccgca aacggtgggg 121 gtcggccggg gccgcttcac cacttacgaa atcagggtca agacaaatct tcctattttc 181 aagctgaaag aatctactgt tagaagaaga tacagtgact ttgaatggct gcgaagtgaa 241 ttagaaagag agagcaaggt cgtagttccc ccgctccctg ggaaagcgtt tttgcgtcag 301 cttcctttta gaggagatga tggaatattt gatgacaatt ttattgagga aagaaaacaa 361 gggctggagc agtttataaa caaggtcgct ggtcatcctc tggcacagaa cgaacgttgt 421 cttcacatgt ttttacaaga tgaaataata gataaaagct atactccatc taaaataaga 481 catgcttaa //