LOCUS       CR456898                 489 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834A047D for
            gene SNX3, sorting nexin 3; complete cds, incl. stopcodon.
ACCESSION   CR456898
VERSION     CR456898.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 489)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 489)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834A047D, ORFNo 1236
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A047D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_003795 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..489
                     /db_xref="H-InvDB:HIT000267748"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834A047D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..489
                     /codon_start=1
                     /gene="SNX3"
                     /db_xref="GOA:O60493"
                     /db_xref="H-InvDB:HIT000267748.12"
                     /db_xref="HGNC:HGNC:11174"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR036871"
                     /db_xref="InterPro:IPR042137"
                     /db_xref="PDB:2MXC"
                     /db_xref="PDB:2YPS"
                     /db_xref="PDB:5F0J"
                     /db_xref="PDB:5F0L"
                     /db_xref="PDB:5F0M"
                     /db_xref="PDB:5F0P"
                     /db_xref="UniProtKB/Swiss-Prot:O60493"
                     /protein_id="CAG33179.1"
                     /translation="MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRG
                     RFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLP
                     FRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIR
                     HA"
BASE COUNT          148 a          108 c          121 g          112 t
ORIGIN      
        1 atggcggaga ccgtggctga cacccggcgg ctgatcacca agccgcagaa cctgaatgac
       61 gcctacggac cccccagcaa cttcctcgag atcgatgtga gcaacccgca aacggtgggg
      121 gtcggccggg gccgcttcac cacttacgaa atcagggtca agacaaatct tcctattttc
      181 aagctgaaag aatctactgt tagaagaaga tacagtgact ttgaatggct gcgaagtgaa
      241 ttagaaagag agagcaaggt cgtagttccc ccgctccctg ggaaagcgtt tttgcgtcag
      301 cttcctttta gaggagatga tggaatattt gatgacaatt ttattgagga aagaaaacaa
      361 gggctggagc agtttataaa caaggtcgct ggtcatcctc tggcacagaa cgaacgttgt
      421 cttcacatgt ttttacaaga tgaaataata gataaaagct atactccatc taaaataaga
      481 catgcttaa
//