LOCUS CR456857 336 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E106D for gene UMPK, uridine monophosphate kinase; complete cds, incl. stopcodon. ACCESSION CR456857 VERSION CR456857.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 336) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 336) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E106D, ORFNo 1141 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E106D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BT006860 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..336 /db_xref="H-InvDB:HIT000267707" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E106D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..336 /codon_start=1 /gene="UMPK" /db_xref="GOA:Q9BZX2" /db_xref="H-InvDB:HIT000267707.12" /db_xref="HGNC:HGNC:12562" /db_xref="InterPro:IPR000764" /db_xref="InterPro:IPR006083" /db_xref="InterPro:IPR027417" /db_xref="InterPro:IPR029925" /db_xref="PDB:1UDW" /db_xref="PDB:1UEI" /db_xref="PDB:1UEJ" /db_xref="PDB:1UFQ" /db_xref="PDB:1UJ2" /db_xref="PDB:1XRJ" /db_xref="UniProtKB/Swiss-Prot:Q9BZX2" /protein_id="CAG33138.1" /translation="MKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFE EFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQ ASESSSRPH" BASE COUNT 90 a 87 c 87 g 72 t ORIGIN 1 atgaagcttt ttgtggatac agatgcggac acccggctct cacgcagagt attaagggac 61 atcagcgaga gaggcaggga tcttgagcag attttatctc agtacattac gttcgtcaag 121 cctgcctttg aggaattctg cttgccaaca aagaagtatg ctgatgtgat catccctaga 181 ggtgcagata atctggtggc catcaacctc atcgtgcagc acatccagga catcctgaat 241 ggagggccct ccaaacggca gaccaatggc tgtctcaacg gctacacccc ttcacgcaag 301 aggcaggcat cggagtccag cagcaggccg cattaa //