LOCUS CR456854 504 bp mRNA linear HUM 03-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F096D for gene CGGBP1, CGG triplet repeat binding protein 1; complete cds, incl. stopcodon. ACCESSION CR456854 VERSION CR456854.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 504) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 504) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F096D, ORFNo 1134 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F096D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence BC052980 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..504 /db_xref="H-InvDB:HIT000267704" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F096D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..504 /codon_start=1 /gene="CGGBP1" /db_xref="GOA:Q9UFW8" /db_xref="H-InvDB:HIT000267704.12" /db_xref="HGNC:HGNC:1888" /db_xref="InterPro:IPR033375" /db_xref="UniProtKB/Swiss-Prot:Q9UFW8" /protein_id="CAG33135.1" /translation="MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCT SCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVS VIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQ LLNSQDC" BASE COUNT 148 a 116 c 120 g 120 t ORIGIN 1 atggagcgat ttgtagtaac agcaccacct gctcgaaacc gttctaagac tgctttgtat 61 gtgactcccc tggatcgagt cactgagttt ggaggtgagc tgcatgaaga tggaggaaaa 121 ctcttctgca cttcttgcaa tgtggttctg aatcatgttc gcaagtctgc cattagtgac 181 cacctcaagt caaagactca taccaagagg aaggcagaat ttgaagagca gaatgtgaga 241 aagaagcaga ggcccctaac tgcatctctt cagtgcaaca gtactgcgca aacagagaaa 301 gtcagtgtta tccaggactt tgtgaaaatg tgcctggaag ccaacatccc acttgagaag 361 gctgatcacc cagcagtccg tgctttccta tctcgccatg tgaagaatgg aggctccata 421 cctaagtcag accagctacg gagggcatat cttcctgatg gatatgagaa tgagaatcaa 481 ctcctcaact cacaagattg ttaa //