LOCUS CR456848 429 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G076D for gene HBZ, hemoglobin, zeta; complete cds, incl. stopcodon. ACCESSION CR456848 VERSION CR456848.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 429) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 429) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G076D, ORFNo 1111 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G076D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_005332 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..429 /db_xref="H-InvDB:HIT000267698" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G076D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..429 /codon_start=1 /gene="HBZ" /db_xref="GOA:P02008" /db_xref="H-InvDB:HIT000267698.14" /db_xref="HGNC:HGNC:4835" /db_xref="InterPro:IPR000971" /db_xref="InterPro:IPR002338" /db_xref="InterPro:IPR002340" /db_xref="InterPro:IPR009050" /db_xref="InterPro:IPR012292" /db_xref="PDB:1JEB" /db_xref="PDB:3W4U" /db_xref="UniProtKB/Swiss-Prot:P02008" /protein_id="CAG33129.1" /translation="MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYF PHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLL SHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR" BASE COUNT 77 a 157 c 119 g 76 t ORIGIN 1 atgtctctga ccaagactga gaggaccatc attgtgtcca tgtgggccaa gatctccacg 61 caggccgaca ccatcggcac cgagactctg gagaggctct tcctcagcca cccgcagacc 121 aagacctact tcccgcactt cgacctgcac ccggggtccg cgcagttgcg cgcgcacggc 181 tccaaggttg tggccgccgt gggcgacgcg gtgaagagca tcgacgacat cggcggcgcc 241 ctgtccaagc tgagcgagct gcacgcctac atcctgcgcg tggacccggt caacttcaag 301 ctcctgtccc actgcctgct ggtcaccctg gccgcgcgct tccccgccga cttcacggcc 361 gaggcccacg ccgcctggga caagttccta tcggtcgtat cctctgtcct gaccgagaag 421 taccgttaa //