LOCUS CR456847 726 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E076D for gene PSMA5, proteasome (prosome, macropain) subunit, alpha type, 5; complete cds, incl. stopcodon. ACCESSION CR456847 VERSION CR456847.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 726) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 726) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E076D, ORFNo 1108 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E076D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_002790 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..726 /db_xref="H-InvDB:HIT000267697" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E076D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..726 /codon_start=1 /gene="PSMA5" /db_xref="GOA:P28066" /db_xref="H-InvDB:HIT000267697.13" /db_xref="HGNC:HGNC:9534" /db_xref="InterPro:IPR000426" /db_xref="InterPro:IPR001353" /db_xref="InterPro:IPR023332" /db_xref="InterPro:IPR029055" /db_xref="InterPro:IPR033812" /db_xref="PDB:4R3O" /db_xref="PDB:4R67" /db_xref="PDB:5A0Q" /db_xref="PDB:5GJQ" /db_xref="PDB:5GJR" /db_xref="PDB:5L4G" /db_xref="PDB:5LE5" /db_xref="PDB:5LEX" /db_xref="PDB:5LEY" /db_xref="PDB:5LEZ" /db_xref="PDB:5LF0" /db_xref="PDB:5LF1" /db_xref="PDB:5LF3" /db_xref="PDB:5LF4" /db_xref="PDB:5LF6" /db_xref="PDB:5LF7" /db_xref="PDB:5LN3" /db_xref="PDB:5M32" /db_xref="PDB:5T0C" /db_xref="PDB:5T0G" /db_xref="PDB:5T0H" /db_xref="PDB:5T0I" /db_xref="PDB:5T0J" /db_xref="PDB:5VFO" /db_xref="PDB:5VFP" /db_xref="PDB:5VFQ" /db_xref="PDB:5VFR" /db_xref="PDB:5VFS" /db_xref="PDB:5VFT" /db_xref="PDB:5VFU" /db_xref="PDB:6AVO" /db_xref="PDB:6MSB" /db_xref="PDB:6MSD" /db_xref="PDB:6MSE" /db_xref="PDB:6MSG" /db_xref="PDB:6MSH" /db_xref="PDB:6MSJ" /db_xref="PDB:6MSK" /db_xref="PDB:6R70" /db_xref="UniProtKB/Swiss-Prot:P28066" /protein_id="CAG33128.1" /translation="MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSE GVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFT YNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSG TFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELA TVQPGQNFHMFTKEELEEVIKDI" BASE COUNT 208 a 147 c 185 g 186 t ORIGIN 1 atgtttctta cccggtctga gtacgacagg ggcgtgaata ctttttctcc cgaaggaaga 61 ttatttcaag tggaatatgc cattgaggct atcaagcttg gttctacagc cattgggatc 121 cagacatcag agggtgtgtg cctagctgtg gagaagagaa ttacttcccc actgatggag 181 cccagcagca ttgagaaaat tgtagagatt gatgctcaca taggttgtgc catgagtggg 241 ctaattgctg atgctaagac tttaattgat aaagccagag tggagacaca gaaccactgg 301 ttcacctaca atgagacaat gacagtggag agtgtgaccc aagctgtgtc caatctggct 361 ttgcagtttg gagaagaaga tgcagatcca ggtgccatgt ctcgtccctt tggagtagca 421 ttattatttg gaggagttga tgagaaagga ccccagctgt ttcatatgga cccatctggg 481 acctttgtac agtgtgatgc tcgagcaatt ggctctgctt cagagggtgc ccagagctcc 541 ttgcaagaag tttatcacaa gtctatgact ttgaaagaag ccatcaagtc ttcactcatc 601 atcctcaaac aagtaatgga ggagaagctg aatgcaacaa acattgagct agccacagtg 661 cagcctggcc agaatttcca catgttcaca aaggaagaac ttgaagaggt tatcaaggac 721 atttaa //