LOCUS       CR456847                 726 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E076D for
            gene PSMA5, proteasome (prosome, macropain) subunit, alpha type, 5;
            complete cds, incl. stopcodon.
ACCESSION   CR456847
VERSION     CR456847.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 726)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 726)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E076D, ORFNo 1108
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E076D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_002790 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..726
                     /db_xref="H-InvDB:HIT000267697"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E076D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..726
                     /codon_start=1
                     /gene="PSMA5"
                     /db_xref="GOA:P28066"
                     /db_xref="H-InvDB:HIT000267697.13"
                     /db_xref="HGNC:HGNC:9534"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="InterPro:IPR033812"
                     /db_xref="PDB:4R3O"
                     /db_xref="PDB:4R67"
                     /db_xref="PDB:5A0Q"
                     /db_xref="PDB:5GJQ"
                     /db_xref="PDB:5GJR"
                     /db_xref="PDB:5L4G"
                     /db_xref="PDB:5LE5"
                     /db_xref="PDB:5LEX"
                     /db_xref="PDB:5LEY"
                     /db_xref="PDB:5LEZ"
                     /db_xref="PDB:5LF0"
                     /db_xref="PDB:5LF1"
                     /db_xref="PDB:5LF3"
                     /db_xref="PDB:5LF4"
                     /db_xref="PDB:5LF6"
                     /db_xref="PDB:5LF7"
                     /db_xref="PDB:5LN3"
                     /db_xref="PDB:5M32"
                     /db_xref="PDB:5T0C"
                     /db_xref="PDB:5T0G"
                     /db_xref="PDB:5T0H"
                     /db_xref="PDB:5T0I"
                     /db_xref="PDB:5T0J"
                     /db_xref="PDB:5VFO"
                     /db_xref="PDB:5VFP"
                     /db_xref="PDB:5VFQ"
                     /db_xref="PDB:5VFR"
                     /db_xref="PDB:5VFS"
                     /db_xref="PDB:5VFT"
                     /db_xref="PDB:5VFU"
                     /db_xref="PDB:6AVO"
                     /db_xref="PDB:6MSB"
                     /db_xref="PDB:6MSD"
                     /db_xref="PDB:6MSE"
                     /db_xref="PDB:6MSG"
                     /db_xref="PDB:6MSH"
                     /db_xref="PDB:6MSJ"
                     /db_xref="PDB:6MSK"
                     /db_xref="PDB:6R70"
                     /db_xref="UniProtKB/Swiss-Prot:P28066"
                     /protein_id="CAG33128.1"
                     /translation="MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSE
                     GVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFT
                     YNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSG
                     TFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELA
                     TVQPGQNFHMFTKEELEEVIKDI"
BASE COUNT          208 a          147 c          185 g          186 t
ORIGIN      
        1 atgtttctta cccggtctga gtacgacagg ggcgtgaata ctttttctcc cgaaggaaga
       61 ttatttcaag tggaatatgc cattgaggct atcaagcttg gttctacagc cattgggatc
      121 cagacatcag agggtgtgtg cctagctgtg gagaagagaa ttacttcccc actgatggag
      181 cccagcagca ttgagaaaat tgtagagatt gatgctcaca taggttgtgc catgagtggg
      241 ctaattgctg atgctaagac tttaattgat aaagccagag tggagacaca gaaccactgg
      301 ttcacctaca atgagacaat gacagtggag agtgtgaccc aagctgtgtc caatctggct
      361 ttgcagtttg gagaagaaga tgcagatcca ggtgccatgt ctcgtccctt tggagtagca
      421 ttattatttg gaggagttga tgagaaagga ccccagctgt ttcatatgga cccatctggg
      481 acctttgtac agtgtgatgc tcgagcaatt ggctctgctt cagagggtgc ccagagctcc
      541 ttgcaagaag tttatcacaa gtctatgact ttgaaagaag ccatcaagtc ttcactcatc
      601 atcctcaaac aagtaatgga ggagaagctg aatgcaacaa acattgagct agccacagtg
      661 cagcctggcc agaatttcca catgttcaca aaggaagaac ttgaagaggt tatcaaggac
      721 atttaa
//