LOCUS CR456833 540 bp mRNA linear HUM 21-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0415D for gene STMN2, stathmin-like 2; complete cds, incl. stopcodon. ACCESSION CR456833 VERSION CR456833.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 540) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 540) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0415D, ORFNo 1071 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0415D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_007029 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..540 /db_xref="H-InvDB:HIT000267683" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0415D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..540 /codon_start=1 /gene="STMN2" /db_xref="GOA:Q93045" /db_xref="H-InvDB:HIT000267683.12" /db_xref="HGNC:HGNC:10577" /db_xref="InterPro:IPR000956" /db_xref="InterPro:IPR026729" /db_xref="InterPro:IPR030514" /db_xref="InterPro:IPR036002" /db_xref="UniProtKB/Swiss-Prot:Q93045" /protein_id="CAG33114.1" /translation="MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQ INKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRKSQEAQV LKQLAEKREHEREVLQKALEENNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEK ERHAAEVRRNKELQVELSG" BASE COUNT 179 a 115 c 142 g 104 t ORIGIN 1 atggctaaaa cagcaatggc ctacaaggaa aaaatgaagg agctgtccat gctgtcactg 61 atctgctctt gcttttaccc ggaacctcgc aacatcaaca tctatactta cgatgatatg 121 gaagtgaagc aaatcaacaa acgtgcctct ggccaggctt ttgagctgat cttgaagcca 181 ccatctccta tctcagaagc cccacgaact ttagcttctc caaagaagaa agacctgtcc 241 ctggaggaga tccagaagaa actggaggct gcagaggaaa gaagaaagtc tcaggaggcc 301 caggtgctga aacaattggc agagaagagg gaacacgagc gagaagtcct tcagaaggct 361 ttggaggaga acaacaactt cagcaagatg gcggaggaaa agctgatcct gaaaatggaa 421 caaattaagg aaaaccgtga ggctaatcta gctgctatta ttgaacgtct gcaggaaaag 481 gagaggcatg ctgcggaggt gcgcaggaac aaggaactcc aggttgaact gtctggttaa //