LOCUS       CR456831                 918 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H0518D for
            gene EIF2B1, eukaryotic translation initiation factor 2B, subunit 1
            alpha, 26kDa; complete cds, incl. stopcodon.
ACCESSION   CR456831
VERSION     CR456831.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 918)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 918)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H0518D, ORFNo 1069
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0518D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_001414 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..918
                     /db_xref="H-InvDB:HIT000267681"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H0518D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..918
                     /codon_start=1
                     /gene="EIF2B1"
                     /db_xref="GOA:Q14232"
                     /db_xref="H-InvDB:HIT000267681.11"
                     /db_xref="HGNC:HGNC:3257"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="InterPro:IPR037171"
                     /db_xref="InterPro:IPR042528"
                     /db_xref="InterPro:IPR042529"
                     /db_xref="PDB:3ECS"
                     /db_xref="PDB:6CAJ"
                     /db_xref="PDB:6EZO"
                     /db_xref="PDB:6K71"
                     /db_xref="PDB:6K72"
                     /db_xref="PDB:6O81"
                     /db_xref="PDB:6O85"
                     /db_xref="PDB:6O9Z"
                     /db_xref="UniProtKB/Swiss-Prot:Q14232"
                     /protein_id="CAG33112.1"
                     /translation="MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQG
                     LRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLR
                     RISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLS
                     GKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVC
                     AKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYT
                     APSLITLLFTDLGVLTPSAVSDELIKLYL"
BASE COUNT          251 a          217 c          229 g          221 t
ORIGIN      
        1 atggacgaca aggagttaat tgaatacttt aagtctcaga tgaaagaaga tcctgacatg
       61 gcctcagcag tggctgccat ccggacgttg ctggagttct tgaagagaga taaaggggag
      121 acaatccagg gtctgagggc gaatctcacc agtgccatag aaaccctgtg tggtgtggac
      181 tcctctgtgg cagtgtcctc tggcggggag ctcttcctcc gcttcatcag tcttgcctcc
      241 ctggaatact ccgattactc caaatgtaaa aagatcatga ttgagcgggg agaacttttt
      301 ctcaggagaa tatcactgtc aagaaacaaa attgcagatc tgtgccatac tttcatcaaa
      361 gatggagcga caatattgac tcacgcctac tccagagtgg tcctgagagt cctggaagca
      421 gccgtggcgg ccaagaagcg atttagtgta tacgtcacag agtcacagcc tgatttgtca
      481 ggtaagaaaa tggccaaagc cctctgccac ctcaacgtcc ctgtcactgt ggtgctagat
      541 gctgctgtcg gctacatcat ggagaaagca gatcttgtca tagttggtgc tgaaggagtt
      601 gttgaaaacg gaggaattat taacaagatt ggaaccaacc agatggctgt gtgtgccaaa
      661 gcacagaaca aacctttcta tgtggttgca gaaagtttca agtttgtccg gctctttcca
      721 ctaaaccagc aagacgtccc agataagttt aagtataagg cagacactct caaggtcgcg
      781 cagactggac aagacctcaa agaggagcat ccgtgggtcg actacactgc cccttcctta
      841 atcactctgc tgtttacaga cctgggcgtg ctgacaccct cagcagtcag cgatgagctc
      901 atcaagctct atctttaa
//