LOCUS CR456831 918 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0518D for gene EIF2B1, eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa; complete cds, incl. stopcodon. ACCESSION CR456831 VERSION CR456831.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 918) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 918) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0518D, ORFNo 1069 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0518D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_001414 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..918 /db_xref="H-InvDB:HIT000267681" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0518D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..918 /codon_start=1 /gene="EIF2B1" /db_xref="GOA:Q14232" /db_xref="H-InvDB:HIT000267681.11" /db_xref="HGNC:HGNC:3257" /db_xref="InterPro:IPR000649" /db_xref="InterPro:IPR037171" /db_xref="InterPro:IPR042528" /db_xref="InterPro:IPR042529" /db_xref="PDB:3ECS" /db_xref="PDB:6CAJ" /db_xref="PDB:6EZO" /db_xref="PDB:6K71" /db_xref="PDB:6K72" /db_xref="PDB:6O81" /db_xref="PDB:6O85" /db_xref="PDB:6O9Z" /db_xref="UniProtKB/Swiss-Prot:Q14232" /protein_id="CAG33112.1" /translation="MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQG LRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLR RISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLS GKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVC AKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYT APSLITLLFTDLGVLTPSAVSDELIKLYL" BASE COUNT 251 a 217 c 229 g 221 t ORIGIN 1 atggacgaca aggagttaat tgaatacttt aagtctcaga tgaaagaaga tcctgacatg 61 gcctcagcag tggctgccat ccggacgttg ctggagttct tgaagagaga taaaggggag 121 acaatccagg gtctgagggc gaatctcacc agtgccatag aaaccctgtg tggtgtggac 181 tcctctgtgg cagtgtcctc tggcggggag ctcttcctcc gcttcatcag tcttgcctcc 241 ctggaatact ccgattactc caaatgtaaa aagatcatga ttgagcgggg agaacttttt 301 ctcaggagaa tatcactgtc aagaaacaaa attgcagatc tgtgccatac tttcatcaaa 361 gatggagcga caatattgac tcacgcctac tccagagtgg tcctgagagt cctggaagca 421 gccgtggcgg ccaagaagcg atttagtgta tacgtcacag agtcacagcc tgatttgtca 481 ggtaagaaaa tggccaaagc cctctgccac ctcaacgtcc ctgtcactgt ggtgctagat 541 gctgctgtcg gctacatcat ggagaaagca gatcttgtca tagttggtgc tgaaggagtt 601 gttgaaaacg gaggaattat taacaagatt ggaaccaacc agatggctgt gtgtgccaaa 661 gcacagaaca aacctttcta tgtggttgca gaaagtttca agtttgtccg gctctttcca 721 ctaaaccagc aagacgtccc agataagttt aagtataagg cagacactct caaggtcgcg 781 cagactggac aagacctcaa agaggagcat ccgtgggtcg actacactgc cccttcctta 841 atcactctgc tgtttacaga cctgggcgtg ctgacaccct cagcagtcag cgatgagctc 901 atcaagctct atctttaa //