LOCUS       CR456825                 678 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E0315D for
            gene EEF1B2, eukaryotic translation elongation factor 1 beta 2;
            complete cds, incl. stopcodon.
ACCESSION   CR456825
VERSION     CR456825.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 678)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 678)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E0315D, ORFNo 1053
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0315D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_021121 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..678
                     /db_xref="H-InvDB:HIT000267675"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E0315D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..678
                     /codon_start=1
                     /gene="EEF1B2"
                     /db_xref="GOA:P24534"
                     /db_xref="H-InvDB:HIT000267675.12"
                     /db_xref="HGNC:HGNC:3208"
                     /db_xref="InterPro:IPR001326"
                     /db_xref="InterPro:IPR014038"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="InterPro:IPR018940"
                     /db_xref="InterPro:IPR036219"
                     /db_xref="InterPro:IPR036282"
                     /db_xref="PDB:1B64"
                     /db_xref="PDB:5DQS"
                     /db_xref="UniProtKB/Swiss-Prot:P24534"
                     /protein_id="CAG33106.1"
                     /translation="MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSP
                     PPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDID
                     LFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEE
                     CVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMD
                     VAAFNKI"
BASE COUNT          209 a          130 c          185 g          154 t
ORIGIN      
        1 atgggtttcg gagacctgaa aagccctgcc ggcctccagg tgctcaacga ttacctggcg
       61 gacaagagct acatcgaggg gtatgtgcca tcacaagcag atgtggcagt atttgaagcc
      121 gtgtccagcc caccgcctgc cgacttgtgt catgccctac gttggtataa tcacatcaag
      181 tcttacgaaa aggaaaaggc cagcctgcca ggagtgaaga aagctttggg caaatatggt
      241 cctgccgatg tggaagacac tacaggaagt ggagctacag atagtaaaga tgatgatgac
      301 attgacctct ttggatctga tgatgaggag gaaagtgaag aagcaaagag gctaagggaa
      361 gaacgtcttg cacaatatga atcaaagaaa gccaaaaaac ctgcacttgt tgccaagtct
      421 tccatcttac tagatgtgaa accttgggat gatgagacag atatggcgaa attagaggag
      481 tgcgtcagaa gcattcaagc agacggctta gtctggggct catctaaact agttccagtg
      541 ggatacggaa ttaagaaact tcaaatacag tgtgtagttg aagatgataa agttggaaca
      601 gatatgctgg aggagcagat cactgctttt gaggactatg tgcagtccat ggatgtggct
      661 gctttcaaca agatttaa
//