LOCUS CR456825 678 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E0315D for gene EEF1B2, eukaryotic translation elongation factor 1 beta 2; complete cds, incl. stopcodon. ACCESSION CR456825 VERSION CR456825.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 678) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 678) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E0315D, ORFNo 1053 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E0315D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_021121 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..678 /db_xref="H-InvDB:HIT000267675" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E0315D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..678 /codon_start=1 /gene="EEF1B2" /db_xref="GOA:P24534" /db_xref="H-InvDB:HIT000267675.12" /db_xref="HGNC:HGNC:3208" /db_xref="InterPro:IPR001326" /db_xref="InterPro:IPR014038" /db_xref="InterPro:IPR014717" /db_xref="InterPro:IPR018940" /db_xref="InterPro:IPR036219" /db_xref="InterPro:IPR036282" /db_xref="PDB:1B64" /db_xref="PDB:5DQS" /db_xref="UniProtKB/Swiss-Prot:P24534" /protein_id="CAG33106.1" /translation="MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSP PPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDID LFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEE CVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMD VAAFNKI" BASE COUNT 209 a 130 c 185 g 154 t ORIGIN 1 atgggtttcg gagacctgaa aagccctgcc ggcctccagg tgctcaacga ttacctggcg 61 gacaagagct acatcgaggg gtatgtgcca tcacaagcag atgtggcagt atttgaagcc 121 gtgtccagcc caccgcctgc cgacttgtgt catgccctac gttggtataa tcacatcaag 181 tcttacgaaa aggaaaaggc cagcctgcca ggagtgaaga aagctttggg caaatatggt 241 cctgccgatg tggaagacac tacaggaagt ggagctacag atagtaaaga tgatgatgac 301 attgacctct ttggatctga tgatgaggag gaaagtgaag aagcaaagag gctaagggaa 361 gaacgtcttg cacaatatga atcaaagaaa gccaaaaaac ctgcacttgt tgccaagtct 421 tccatcttac tagatgtgaa accttgggat gatgagacag atatggcgaa attagaggag 481 tgcgtcagaa gcattcaagc agacggctta gtctggggct catctaaact agttccagtg 541 ggatacggaa ttaagaaact tcaaatacag tgtgtagttg aagatgataa agttggaaca 601 gatatgctgg aggagcagat cactgctttt gaggactatg tgcagtccat ggatgtggct 661 gctttcaaca agatttaa //