LOCUS CR456812 1164 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0118D for gene BBOX1, butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1; complete cds, incl. stopcodon. ACCESSION CR456812 VERSION CR456812.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1164) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1164) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0118D, ORFNo 1014 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0118D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_003986 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1164 /db_xref="H-InvDB:HIT000267662" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0118D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1164 /codon_start=1 /gene="BBOX1" /db_xref="GOA:O75936" /db_xref="H-InvDB:HIT000267662.11" /db_xref="HGNC:HGNC:964" /db_xref="InterPro:IPR003819" /db_xref="InterPro:IPR010376" /db_xref="InterPro:IPR012775" /db_xref="InterPro:IPR038492" /db_xref="InterPro:IPR042098" /db_xref="PDB:3MS5" /db_xref="PDB:3N6W" /db_xref="PDB:3O2G" /db_xref="PDB:4BG1" /db_xref="PDB:4BGK" /db_xref="PDB:4BGM" /db_xref="PDB:4BHF" /db_xref="PDB:4BHG" /db_xref="PDB:4BHI" /db_xref="PDB:4C5W" /db_xref="PDB:4C8R" /db_xref="PDB:4CWD" /db_xref="UniProtKB/Swiss-Prot:O75936" /protein_id="CAG33093.1" /translation="MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCY LDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARA KLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPG EVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLH CIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHK IIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNP GDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN" BASE COUNT 354 a 231 c 269 g 310 t ORIGIN 1 atggcttgta ccatccaaaa ggcagaagca cttgacgggg ctcatttgat gcagatcctc 61 tggtatgatg aggaagagtc tctctaccca gctgtatggt tgagagacaa ctgtccgtgc 121 tctgattgct acctggattc tgcaaaagca cggaaacttc tagtggaagc tcttgatgtg 181 aacattggaa ttaaaggctt gatatttgac agaaaaaagg tgtacatcac atggcccgat 241 gagcattaca gtgaattcca ggctgattgg ctgaagaaaa gatgcttttc caagcaggcc 301 agagcaaagc tccaaagaga attgtttttt ccagaatgcc aatactgggg ctcagagctc 361 cagctaccca ctttggattt tgaagatgtt ttaagatatg atgaacacgc atacaagtgg 421 ctctccaccc tcaagaaagt aggcatagta agactcaccg gagcatctga caaaccagga 481 gaagtttcaa aacttgggaa aaggatgggt ttcctctatc tcacatttta tggacatact 541 tggcaagtgc aagacaaaat cgatgcaaac aatgtggctt acacaactgg gaagctaagc 601 tttcacactg attatccagc cctccatcat ccacccgggg ttcagcttct tcactgcata 661 aagcaaacag tcacaggggg tgattcagaa attgtagatg ggtttaatgt gtgccaaaaa 721 ctaaagaaaa ataatcctca ggcattccag attttgtcct ctacctttgt ggactttaca 781 gacattggag tggattactg tgatttttct gtacaatcaa aacataaaat tatagagtta 841 gatgataaag gccaagtggt tcgcatcaac ttcaataacg caactaggga cacaatattt 901 gatgtgcctg ttgaaagagt tcagcctttt tatgctgctc tgaaggagtt tgttgacctc 961 atgaacagca aagaatccaa gtttaccttc aagatgaatc caggtgatgt gattactttt 1021 gataactggc gcttacttca tggccgacgt agctatgaag caggaactga gatatcccgc 1081 catctagaag gagcttatgc tgactgggat gtggtcatgt caaggcttcg tatcttaagg 1141 cagagggtgg agaatggaaa ttaa //