LOCUS       CR456812                1164 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834H0118D for
            gene BBOX1, butyrobetaine (gamma), 2-oxoglutarate dioxygenase
            (gamma-butyrobetaine hydroxylase) 1; complete cds, incl. stopcodon.
ACCESSION   CR456812
VERSION     CR456812.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1164)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1164)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834H0118D, ORFNo 1014
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0118D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_003986 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1164
                     /db_xref="H-InvDB:HIT000267662"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834H0118D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1164
                     /codon_start=1
                     /gene="BBOX1"
                     /db_xref="GOA:O75936"
                     /db_xref="H-InvDB:HIT000267662.11"
                     /db_xref="HGNC:HGNC:964"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="InterPro:IPR010376"
                     /db_xref="InterPro:IPR012775"
                     /db_xref="InterPro:IPR038492"
                     /db_xref="InterPro:IPR042098"
                     /db_xref="PDB:3MS5"
                     /db_xref="PDB:3N6W"
                     /db_xref="PDB:3O2G"
                     /db_xref="PDB:4BG1"
                     /db_xref="PDB:4BGK"
                     /db_xref="PDB:4BGM"
                     /db_xref="PDB:4BHF"
                     /db_xref="PDB:4BHG"
                     /db_xref="PDB:4BHI"
                     /db_xref="PDB:4C5W"
                     /db_xref="PDB:4C8R"
                     /db_xref="PDB:4CWD"
                     /db_xref="UniProtKB/Swiss-Prot:O75936"
                     /protein_id="CAG33093.1"
                     /translation="MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCY
                     LDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARA
                     KLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPG
                     EVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLH
                     CIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHK
                     IIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNP
                     GDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN"
BASE COUNT          354 a          231 c          269 g          310 t
ORIGIN      
        1 atggcttgta ccatccaaaa ggcagaagca cttgacgggg ctcatttgat gcagatcctc
       61 tggtatgatg aggaagagtc tctctaccca gctgtatggt tgagagacaa ctgtccgtgc
      121 tctgattgct acctggattc tgcaaaagca cggaaacttc tagtggaagc tcttgatgtg
      181 aacattggaa ttaaaggctt gatatttgac agaaaaaagg tgtacatcac atggcccgat
      241 gagcattaca gtgaattcca ggctgattgg ctgaagaaaa gatgcttttc caagcaggcc
      301 agagcaaagc tccaaagaga attgtttttt ccagaatgcc aatactgggg ctcagagctc
      361 cagctaccca ctttggattt tgaagatgtt ttaagatatg atgaacacgc atacaagtgg
      421 ctctccaccc tcaagaaagt aggcatagta agactcaccg gagcatctga caaaccagga
      481 gaagtttcaa aacttgggaa aaggatgggt ttcctctatc tcacatttta tggacatact
      541 tggcaagtgc aagacaaaat cgatgcaaac aatgtggctt acacaactgg gaagctaagc
      601 tttcacactg attatccagc cctccatcat ccacccgggg ttcagcttct tcactgcata
      661 aagcaaacag tcacaggggg tgattcagaa attgtagatg ggtttaatgt gtgccaaaaa
      721 ctaaagaaaa ataatcctca ggcattccag attttgtcct ctacctttgt ggactttaca
      781 gacattggag tggattactg tgatttttct gtacaatcaa aacataaaat tatagagtta
      841 gatgataaag gccaagtggt tcgcatcaac ttcaataacg caactaggga cacaatattt
      901 gatgtgcctg ttgaaagagt tcagcctttt tatgctgctc tgaaggagtt tgttgacctc
      961 atgaacagca aagaatccaa gtttaccttc aagatgaatc caggtgatgt gattactttt
     1021 gataactggc gcttacttca tggccgacgt agctatgaag caggaactga gatatcccgc
     1081 catctagaag gagcttatgc tgactgggat gtggtcatgt caaggcttcg tatcttaagg
     1141 cagagggtgg agaatggaaa ttaa
//