LOCUS CR456801 897 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D0119D for gene KHK, ketohexokinase (fructokinase); complete cds, incl. stopcodon. ACCESSION CR456801 VERSION CR456801.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 897) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 897) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D0119D, ORFNo 972 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0119D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_000221 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..897 /db_xref="H-InvDB:HIT000267651" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D0119D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..897 /codon_start=1 /gene="KHK" /db_xref="GOA:P50053" /db_xref="H-InvDB:HIT000267651.13" /db_xref="HGNC:HGNC:6315" /db_xref="InterPro:IPR011611" /db_xref="InterPro:IPR029056" /db_xref="InterPro:IPR034093" /db_xref="PDB:2HLZ" /db_xref="PDB:2HQQ" /db_xref="PDB:2HW1" /db_xref="PDB:3B3L" /db_xref="PDB:3NBV" /db_xref="PDB:3NBW" /db_xref="PDB:3NC2" /db_xref="PDB:3NC9" /db_xref="PDB:3NCA" /db_xref="PDB:3Q92" /db_xref="PDB:3QA2" /db_xref="PDB:3QAI" /db_xref="PDB:3RO4" /db_xref="PDB:5WBM" /db_xref="PDB:5WBO" /db_xref="PDB:5WBP" /db_xref="PDB:5WBQ" /db_xref="PDB:5WBR" /db_xref="PDB:5WBZ" /db_xref="UniProtKB/Swiss-Prot:P50053" /protein_id="CAG33082.1" /translation="MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNAS NSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIIN EASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQ PPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKG AVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQE ALRFGCQVAGKKCGLQGFDGIV" BASE COUNT 183 a 240 c 285 g 189 t ORIGIN 1 atggaagaga agcagatcct gtgcgtgggg ctagtggtgc tggacgtcat cagcctggtg 61 gacaagtacc ctaaggagga ctcggagata aggtgtttgt cccagagatg gcagcgcgga 121 ggcaacgcgt ccaactcctg caccgttctc tccctgctcg gagccccctg tgccttcatg 181 ggctcaatgg ctcctggcca tgttgctgat tttgtcctgg atgacctccg ccgctattct 241 gtggacctac gctacacagt ctttcagacc acaggctccg tccccatcgc cacggtcatc 301 atcaacgagg ccagtggtag ccgcaccatc ctatactatg acaggagcct gccagatgtg 361 tctgctacag actttgagaa ggttgatctg acccagttca agtggatcca cattgagggc 421 cggaacgcat cggagcaggt gaagatgctg cagcggatag acgcacacaa caccaggcag 481 cctccagagc agaagatccg ggtgtccgtg gaggtggaga agccacgaga ggagctcttc 541 cagctgtttg gctacggaga cgtggtgttt gtcagcaaag atgtggccaa gcacttgggg 601 ttccagtcag cagaggaagc cttgaggggc ttgtatggtc gtgtgaggaa aggggctgtg 661 cttgtctgtg cctgggctga ggagggcgcc gacgccctgg gccctgatgg caaattgctc 721 cactcggatg ctttcccgcc accccgcgtg gtggatacac tgggagctgg agacaccttc 781 aatgcctccg tcatcttcag cctctcccag gggaggagcg tgcaggaagc actgagattc 841 gggtgccagg tggccggcaa gaagtgtggc ctgcagggct ttgatggcat cgtttaa //