LOCUS       CR456801                 897 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D0119D for
            gene KHK, ketohexokinase (fructokinase); complete cds, incl.
            stopcodon.
ACCESSION   CR456801
VERSION     CR456801.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 897)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 897)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D0119D, ORFNo 972
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D0119D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_000221 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..897
                     /db_xref="H-InvDB:HIT000267651"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D0119D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..897
                     /codon_start=1
                     /gene="KHK"
                     /db_xref="GOA:P50053"
                     /db_xref="H-InvDB:HIT000267651.13"
                     /db_xref="HGNC:HGNC:6315"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="InterPro:IPR034093"
                     /db_xref="PDB:2HLZ"
                     /db_xref="PDB:2HQQ"
                     /db_xref="PDB:2HW1"
                     /db_xref="PDB:3B3L"
                     /db_xref="PDB:3NBV"
                     /db_xref="PDB:3NBW"
                     /db_xref="PDB:3NC2"
                     /db_xref="PDB:3NC9"
                     /db_xref="PDB:3NCA"
                     /db_xref="PDB:3Q92"
                     /db_xref="PDB:3QA2"
                     /db_xref="PDB:3QAI"
                     /db_xref="PDB:3RO4"
                     /db_xref="PDB:5WBM"
                     /db_xref="PDB:5WBO"
                     /db_xref="PDB:5WBP"
                     /db_xref="PDB:5WBQ"
                     /db_xref="PDB:5WBR"
                     /db_xref="PDB:5WBZ"
                     /db_xref="UniProtKB/Swiss-Prot:P50053"
                     /protein_id="CAG33082.1"
                     /translation="MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNAS
                     NSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIIN
                     EASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQ
                     PPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKG
                     AVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQE
                     ALRFGCQVAGKKCGLQGFDGIV"
BASE COUNT          183 a          240 c          285 g          189 t
ORIGIN      
        1 atggaagaga agcagatcct gtgcgtgggg ctagtggtgc tggacgtcat cagcctggtg
       61 gacaagtacc ctaaggagga ctcggagata aggtgtttgt cccagagatg gcagcgcgga
      121 ggcaacgcgt ccaactcctg caccgttctc tccctgctcg gagccccctg tgccttcatg
      181 ggctcaatgg ctcctggcca tgttgctgat tttgtcctgg atgacctccg ccgctattct
      241 gtggacctac gctacacagt ctttcagacc acaggctccg tccccatcgc cacggtcatc
      301 atcaacgagg ccagtggtag ccgcaccatc ctatactatg acaggagcct gccagatgtg
      361 tctgctacag actttgagaa ggttgatctg acccagttca agtggatcca cattgagggc
      421 cggaacgcat cggagcaggt gaagatgctg cagcggatag acgcacacaa caccaggcag
      481 cctccagagc agaagatccg ggtgtccgtg gaggtggaga agccacgaga ggagctcttc
      541 cagctgtttg gctacggaga cgtggtgttt gtcagcaaag atgtggccaa gcacttgggg
      601 ttccagtcag cagaggaagc cttgaggggc ttgtatggtc gtgtgaggaa aggggctgtg
      661 cttgtctgtg cctgggctga ggagggcgcc gacgccctgg gccctgatgg caaattgctc
      721 cactcggatg ctttcccgcc accccgcgtg gtggatacac tgggagctgg agacaccttc
      781 aatgcctccg tcatcttcag cctctcccag gggaggagcg tgcaggaagc actgagattc
      841 gggtgccagg tggccggcaa gaagtgtggc ctgcagggct ttgatggcat cgtttaa
//