LOCUS CR456795 1602 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C1021D for gene PHGDH, phosphoglycerate dehydrogenase; complete cds, incl. stopcodon. ACCESSION CR456795 VERSION CR456795.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1602) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1602) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C1021D, ORFNo 954 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C1021D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_006623 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1602 /db_xref="H-InvDB:HIT000267645" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C1021D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1602 /codon_start=1 /gene="PHGDH" /db_xref="GOA:O43175" /db_xref="H-InvDB:HIT000267645.13" /db_xref="HGNC:HGNC:8923" /db_xref="InterPro:IPR006139" /db_xref="InterPro:IPR006140" /db_xref="InterPro:IPR006236" /db_xref="InterPro:IPR029009" /db_xref="InterPro:IPR029752" /db_xref="InterPro:IPR029753" /db_xref="InterPro:IPR036291" /db_xref="PDB:2G76" /db_xref="PDB:5N53" /db_xref="PDB:5N6C" /db_xref="PDB:5NZO" /db_xref="PDB:5NZP" /db_xref="PDB:5NZQ" /db_xref="PDB:5OFM" /db_xref="PDB:5OFV" /db_xref="PDB:5OFW" /db_xref="UniProtKB/Swiss-Prot:O43175" /protein_id="CAG33076.1" /translation="MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAE LQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGN SLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREV ATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLN DNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHE NVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIG LAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVN AKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNG AVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHV MGISSLLPSLEAWKQHVTEAFQFHF" BASE COUNT 338 a 438 c 500 g 326 t ORIGIN 1 atggcttttg caaatctgcg gaaagtgctc atcagtgaca gcctggaccc ttgctgccgg 61 aagatcttgc aagatggagg gctgcaggtg gtggaaaagc agaaccttag caaagaggag 121 ctgatagcgg agctgcagga ctgtgaaggc cttattgttc gctctgccac caaggtgacc 181 gctgatgtca tcaacgcagc tgagaaactc caggtggtgg gcagggctgg cacaggtgtg 241 gacaatgtgg atctggaggc cgcaacaagg aagggcatct tggttatgaa cacccccaat 301 gggaacagcc tcagtgccgc agaactcact tgtggaatga tcatgtgcct ggccaggcag 361 attccccagg cgacggcttc gatgaaggac ggcaaatggg agcggaagaa gttcatggga 421 acagagctga atggaaagac cctgggaatt cttggcctgg gcaggattgg gagagaggta 481 gctacccgga tgcagtcctt tgggatgaag actatagggt atgaccccat catttcccca 541 gaggtctcgg cctcctttgg tgttcagcag ctgcccctgg aggagatctg gcctctctgt 601 gatttcatca ctgtgcacac tcctctcctg ccctccacga caggcttgct gaatgacaac 661 acctttgccc agtgcaagaa gggggtgcgt gtggtgaact gtgcccgtgg agggatcgtg 721 gacgaaggcg ccctgctccg ggccctgcag tctggccagt gtgccggggc tgcactggac 781 gtgtttacgg aagagccgcc acgggaccgg gccttggtgg accatgagaa tgtcatcagc 841 tgtccccacc tgggtgccag caccaaggag gctcagagcc gctgtgggga ggaaattgct 901 gttcagttcg tggacatggt gaaggggaaa tctctcacgg gggttgtgaa tgcccaggcc 961 cttaccagtg ccttctctcc acacaccaag ccttggattg gtctggcaga agctctgggg 1021 acactgatgc gagcctgggc tgggtccccc aaagggacca tccaggtgat aacacaggga 1081 acatccctga agaatgctgg gaactgccta agccccgcag tcattgtcgg cctcctgaaa 1141 gaggcttcca agcaggcgga tgtgaacttg gtgaacgcta agctgctggt gaaagaggct 1201 ggcctcaatg tcaccacctc ccacagccct gctgcaccag gggagcaagg cttcggggaa 1261 tgcctcctgg ccgtggccct ggcaggcgcc ccttaccagg ctgtgggctt ggtccaaggc 1321 actacacctg tactgcaggg gctcaatgga gctgtcttca ggccagaagt gcctctccgc 1381 agggacctgc ccctgctcct attccggact cagacctctg accctgcaat gctgcctacc 1441 atgattggcc tcctggcaga ggcaggcgtg cggctgctgt cctaccagac ttcactggtg 1501 tcagatgggg agacctggca cgtcatgggc atctcctcct tgctgcccag cctggaagcg 1561 tggaagcagc atgtgactga agccttccag ttccactttt aa //