LOCUS       CR456795                1602 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C1021D for
            gene PHGDH, phosphoglycerate dehydrogenase; complete cds, incl.
            stopcodon.
ACCESSION   CR456795
VERSION     CR456795.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1602)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1602)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C1021D, ORFNo 954
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C1021D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_006623 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1602
                     /db_xref="H-InvDB:HIT000267645"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C1021D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1602
                     /codon_start=1
                     /gene="PHGDH"
                     /db_xref="GOA:O43175"
                     /db_xref="H-InvDB:HIT000267645.13"
                     /db_xref="HGNC:HGNC:8923"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR006236"
                     /db_xref="InterPro:IPR029009"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PDB:2G76"
                     /db_xref="PDB:5N53"
                     /db_xref="PDB:5N6C"
                     /db_xref="PDB:5NZO"
                     /db_xref="PDB:5NZP"
                     /db_xref="PDB:5NZQ"
                     /db_xref="PDB:5OFM"
                     /db_xref="PDB:5OFV"
                     /db_xref="PDB:5OFW"
                     /db_xref="UniProtKB/Swiss-Prot:O43175"
                     /protein_id="CAG33076.1"
                     /translation="MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAE
                     LQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGN
                     SLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREV
                     ATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLN
                     DNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHE
                     NVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIG
                     LAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVN
                     AKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNG
                     AVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHV
                     MGISSLLPSLEAWKQHVTEAFQFHF"
BASE COUNT          338 a          438 c          500 g          326 t
ORIGIN      
        1 atggcttttg caaatctgcg gaaagtgctc atcagtgaca gcctggaccc ttgctgccgg
       61 aagatcttgc aagatggagg gctgcaggtg gtggaaaagc agaaccttag caaagaggag
      121 ctgatagcgg agctgcagga ctgtgaaggc cttattgttc gctctgccac caaggtgacc
      181 gctgatgtca tcaacgcagc tgagaaactc caggtggtgg gcagggctgg cacaggtgtg
      241 gacaatgtgg atctggaggc cgcaacaagg aagggcatct tggttatgaa cacccccaat
      301 gggaacagcc tcagtgccgc agaactcact tgtggaatga tcatgtgcct ggccaggcag
      361 attccccagg cgacggcttc gatgaaggac ggcaaatggg agcggaagaa gttcatggga
      421 acagagctga atggaaagac cctgggaatt cttggcctgg gcaggattgg gagagaggta
      481 gctacccgga tgcagtcctt tgggatgaag actatagggt atgaccccat catttcccca
      541 gaggtctcgg cctcctttgg tgttcagcag ctgcccctgg aggagatctg gcctctctgt
      601 gatttcatca ctgtgcacac tcctctcctg ccctccacga caggcttgct gaatgacaac
      661 acctttgccc agtgcaagaa gggggtgcgt gtggtgaact gtgcccgtgg agggatcgtg
      721 gacgaaggcg ccctgctccg ggccctgcag tctggccagt gtgccggggc tgcactggac
      781 gtgtttacgg aagagccgcc acgggaccgg gccttggtgg accatgagaa tgtcatcagc
      841 tgtccccacc tgggtgccag caccaaggag gctcagagcc gctgtgggga ggaaattgct
      901 gttcagttcg tggacatggt gaaggggaaa tctctcacgg gggttgtgaa tgcccaggcc
      961 cttaccagtg ccttctctcc acacaccaag ccttggattg gtctggcaga agctctgggg
     1021 acactgatgc gagcctgggc tgggtccccc aaagggacca tccaggtgat aacacaggga
     1081 acatccctga agaatgctgg gaactgccta agccccgcag tcattgtcgg cctcctgaaa
     1141 gaggcttcca agcaggcgga tgtgaacttg gtgaacgcta agctgctggt gaaagaggct
     1201 ggcctcaatg tcaccacctc ccacagccct gctgcaccag gggagcaagg cttcggggaa
     1261 tgcctcctgg ccgtggccct ggcaggcgcc ccttaccagg ctgtgggctt ggtccaaggc
     1321 actacacctg tactgcaggg gctcaatgga gctgtcttca ggccagaagt gcctctccgc
     1381 agggacctgc ccctgctcct attccggact cagacctctg accctgcaat gctgcctacc
     1441 atgattggcc tcctggcaga ggcaggcgtg cggctgctgt cctaccagac ttcactggtg
     1501 tcagatgggg agacctggca cgtcatgggc atctcctcct tgctgcccag cctggaagcg
     1561 tggaagcagc atgtgactga agccttccag ttccactttt aa
//