LOCUS CR456789 261 bp mRNA linear HUM 03-JUN-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G114D for gene COX6B, cytochrome c oxidase subunit VIb; complete cds, incl. stopcodon. ACCESSION CR456789 VERSION CR456789.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 261) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 261) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G114D, ORFNo 943 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G114D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_001863 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..261 /db_xref="H-InvDB:HIT000267639" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G114D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..261 /codon_start=1 /gene="COX6B" /db_xref="GOA:P14854" /db_xref="H-InvDB:HIT000267639.12" /db_xref="HGNC:HGNC:2280" /db_xref="InterPro:IPR003213" /db_xref="InterPro:IPR036549" /db_xref="PDB:5Z62" /db_xref="UniProtKB/Swiss-Prot:P14854" /protein_id="CAG33070.1" /translation="MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAM TAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI" BASE COUNT 73 a 74 c 67 g 47 t ORIGIN 1 atggcggaag acatggagac caaaatcaag aactacaaga ccgccccttt tgacagccgc 61 ttccccaacc agaaccagac tagaaactgc tggcagaact acctggactt ccaccgctgt 121 cagaaggcaa tgaccgctaa aggaggcgat atctctgtgt gcgaatggta ccagcgtgtg 181 taccagtccc tctgccccac atcctgggtc acagactggg atgagcaacg ggctgaaggc 241 acgtttcccg ggaagattta a //