LOCUS CR456782 1020 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G014D for gene IGBP1, immunoglobulin (CD79A) binding protein 1; complete cds, incl. stopcodon. ACCESSION CR456782 VERSION CR456782.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1020) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1020) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G014D, ORFNo 930 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G014D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_001551 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1020 /db_xref="H-InvDB:HIT000267632" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G014D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1020 /codon_start=1 /gene="IGBP1" /db_xref="H-InvDB:HIT000267632.12" /protein_id="CAG33063.1" /translation="MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFK GLDLLEKAAEMLSQLDLFSRNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHL QRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQ RYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKIL RERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRK YGALPDQGIAKAAPEEFRKAAQQQEEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGN RQNMG" BASE COUNT 310 a 227 c 267 g 216 t ORIGIN 1 atggctgctg aggacgagtt acagctgccg cggctccccg agctgttcga aactggtaga 61 cagttactgg acgaagtaga agtggcgact gaacccgccg gttcccggat agtccaggag 121 aaggtgttca agggcttgga cctccttgag aaggctgccg aaatgttatc gcagctcgac 181 ttgttcagcc gaaatgaaga tttggaagag attgcttcca ccgacctgaa gtaccttttg 241 gtgccagcgt ttcaaggagc cctcaccatg aaacaagtca accccagcaa gcgtctagat 301 catttgcagc gggctcgaga acactttata aactacttaa ctcagtgcca ttgctatcat 361 gtggcagagt ttgagctgcc caaaaccatg aacaactctg ctgaaaatca cactgccaat 421 tcctccatgg cttatcctag tctcgttgct atggcatctc aaagacaggc taaaatacag 481 agatacaagc agaagaagga gttggagcat aggttgtctg caatgaaatc tgctgtggaa 541 agtggtcaag cagatgatga gcgtgttcgt gaatattatc ttcttcacct tcagaggtgg 601 attgatatca gcttagaaga gattgagagc attgaccagg aaataaagat cctgagagaa 661 agagactctt caagagaggc atcaacttct aactcatctc gccaggagag gcctccagtg 721 aaacccttca ttctcactcg gaacatggct caagccaaag tatttggagc tggttatcca 781 agtctgccaa ctatgacggt gagtgactgg tatgagcaac atcggaaata tggagcatta 841 ccggatcagg gaatagccaa ggcagcacca gaggaattca gaaaagcagc tcagcaacag 901 gaagaacaag aagaaaagga ggaagaggat gatgaacaaa cactccacag agcccgggag 961 tgggatgact ggaaggacac ccatcctagg ggctatggga accgacagaa catgggttaa //