LOCUS       CR456782                1020 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834G014D for
            gene IGBP1, immunoglobulin (CD79A) binding protein 1; complete cds,
            incl. stopcodon.
ACCESSION   CR456782
VERSION     CR456782.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1020)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1020)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834G014D, ORFNo 930
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G014D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_001551 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1020
                     /db_xref="H-InvDB:HIT000267632"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834G014D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1020
                     /codon_start=1
                     /gene="IGBP1"
                     /db_xref="H-InvDB:HIT000267632.12"
                     /protein_id="CAG33063.1"
                     /translation="MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFK
                     GLDLLEKAAEMLSQLDLFSRNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHL
                     QRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQ
                     RYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKIL
                     RERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRK
                     YGALPDQGIAKAAPEEFRKAAQQQEEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGN
                     RQNMG"
BASE COUNT          310 a          227 c          267 g          216 t
ORIGIN      
        1 atggctgctg aggacgagtt acagctgccg cggctccccg agctgttcga aactggtaga
       61 cagttactgg acgaagtaga agtggcgact gaacccgccg gttcccggat agtccaggag
      121 aaggtgttca agggcttgga cctccttgag aaggctgccg aaatgttatc gcagctcgac
      181 ttgttcagcc gaaatgaaga tttggaagag attgcttcca ccgacctgaa gtaccttttg
      241 gtgccagcgt ttcaaggagc cctcaccatg aaacaagtca accccagcaa gcgtctagat
      301 catttgcagc gggctcgaga acactttata aactacttaa ctcagtgcca ttgctatcat
      361 gtggcagagt ttgagctgcc caaaaccatg aacaactctg ctgaaaatca cactgccaat
      421 tcctccatgg cttatcctag tctcgttgct atggcatctc aaagacaggc taaaatacag
      481 agatacaagc agaagaagga gttggagcat aggttgtctg caatgaaatc tgctgtggaa
      541 agtggtcaag cagatgatga gcgtgttcgt gaatattatc ttcttcacct tcagaggtgg
      601 attgatatca gcttagaaga gattgagagc attgaccagg aaataaagat cctgagagaa
      661 agagactctt caagagaggc atcaacttct aactcatctc gccaggagag gcctccagtg
      721 aaacccttca ttctcactcg gaacatggct caagccaaag tatttggagc tggttatcca
      781 agtctgccaa ctatgacggt gagtgactgg tatgagcaac atcggaaata tggagcatta
      841 ccggatcagg gaatagccaa ggcagcacca gaggaattca gaaaagcagc tcagcaacag
      901 gaagaacaag aagaaaagga ggaagaggat gatgaacaaa cactccacag agcccgggag
      961 tgggatgact ggaaggacac ccatcctagg ggctatggga accgacagaa catgggttaa
//