LOCUS CR456766 558 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D084D for gene CBX1, chromobox homolog 1 (HP1 beta homolog Drosophila ); complete cds, incl. stopcodon. ACCESSION CR456766 VERSION CR456766.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 558) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 558) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D084D, ORFNo 894 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D084D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_006807 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..558 /db_xref="H-InvDB:HIT000267616" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D084D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..558 /codon_start=1 /gene="CBX1" /db_xref="GOA:Q6IBN6" /db_xref="H-InvDB:HIT000267616.12" /db_xref="InterPro:IPR000953" /db_xref="InterPro:IPR008251" /db_xref="InterPro:IPR016197" /db_xref="InterPro:IPR017984" /db_xref="InterPro:IPR023779" /db_xref="InterPro:IPR023780" /db_xref="UniProtKB/TrEMBL:Q6IBN6" /protein_id="CAG33047.1" /translation="MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKG FSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKK KKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVV ISFYEERLTWHSYPSEDDDKKDDKN" BASE COUNT 193 a 100 c 166 g 99 t ORIGIN 1 atggggaaaa aacaaaacaa gaagaaagtg gaggaggtgc tagaagagga ggaagaggaa 61 tatgtggtgg aaaaagttct cgaccgtcga gtggtaaagg gcaaagtgga gtacctccta 121 aagtggaagg gattctcaga tgaggacaac acatgggagc cagaagagaa cctggattgc 181 cccgacctca ttgctgagtt tctgcagtca cagaaaacag cacatgagac agataaatca 241 gagggaggca agcgcaaagc tgattctgat tctgaagata agggagagga gagcaaacca 301 aagaagaaga aagaagagtc agaaaagcca cgaggctttg ctcgaggttt ggagccggag 361 cggattattg gagctacaga ctccagtgga gagctcatgt tcctgatgaa atggaaaaac 421 tctgatgagg ctgacctggt ccctgccaag gaagccaatg tcaagtgccc acaggttgtc 481 atatccttct atgaggaaag gctgacgtgg cattcctacc cctcggagga tgatgacaaa 541 aaagatgaca agaattaa //