LOCUS CR456765 930 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D054D for gene TOMM34, translocase of outer mitochondrial membrane 34; complete cds, incl. stopcodon. ACCESSION CR456765 VERSION CR456765.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 930) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 930) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D054D, ORFNo 888 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D054D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_006809 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..930 /db_xref="H-InvDB:HIT000267615" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D054D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..930 /codon_start=1 /gene="TOMM34" /db_xref="GOA:Q15785" /db_xref="H-InvDB:HIT000267615.13" /db_xref="HGNC:HGNC:15746" /db_xref="InterPro:IPR001440" /db_xref="InterPro:IPR011990" /db_xref="InterPro:IPR013026" /db_xref="InterPro:IPR019734" /db_xref="UniProtKB/Swiss-Prot:Q15785" /protein_id="CAG33046.1" /translation="MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGS SDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYP MAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNS LPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSE SLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKD YKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH" BASE COUNT 267 a 234 c 247 g 182 t ORIGIN 1 atggccccca aattcccaga ctctgtggag gagctccgcg ccgccggcaa tgagagtttc 61 cgcaacggcc agtacgccga ggcctccgcg ctctacggcc gcgcgctgcg ggtgctgcag 121 gcgcaaggtt cttcagaccc agaagaagaa agtgttctct actccaaccg agcagcatgt 181 cacttgaagg atggaaactg cagagactgc atcaaagatt gcacttcagc actggccttg 241 gttcccttca gcattaagcc cctgctgcgg cgagcatctg cttatgaggc tctggagaag 301 taccctatgg cctatgttga ctataagact gtgctgcaga ttgatgataa tgtgacgtca 361 gccgtagaag gcatcaacag aatgaccaga gctctcatgg actcgcttgg gcctgagtgg 421 cgcctgaagc tgccctcaat ccccttggtg cctgtttcag ctcagaagag gtggaattcc 481 ttgccttcgg agaaccacaa agagatggct aaaagcaaat ccaaagaaac cacagctaca 541 aagaacagag tgccttctgc tggggatgtg gagaaagcca gagttctgaa ggaagaaggc 601 aatgagcttg taaagaaggg aaaccataag aaagctattg agaagtacag tgaaagcctc 661 ttgtgtagta acctggaatc tgccacgtac agcaacagag cactctgcta tttggtcctg 721 aagcagtaca cagaagcagt gaaggactgc acagaagccc tcaagctgga tggaaagaac 781 gtgaaggcat tctacagacg ggctcaagcc cacaaagcac tcaaggacta taaatccagc 841 tttgcagaca tcagcaacct cctacagatt gagcctagga atggtcctgc acagaagttg 901 cggcaggaag tgaagcagaa cctacattaa //