LOCUS       CR456765                 930 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834D054D for
            gene TOMM34, translocase of outer mitochondrial membrane 34;
            complete cds, incl. stopcodon.
ACCESSION   CR456765
VERSION     CR456765.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 930)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 930)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834D054D, ORFNo 888
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D054D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_006809 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..930
                     /db_xref="H-InvDB:HIT000267615"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834D054D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..930
                     /codon_start=1
                     /gene="TOMM34"
                     /db_xref="GOA:Q15785"
                     /db_xref="H-InvDB:HIT000267615.13"
                     /db_xref="HGNC:HGNC:15746"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/Swiss-Prot:Q15785"
                     /protein_id="CAG33046.1"
                     /translation="MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGS
                     SDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYP
                     MAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNS
                     LPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSE
                     SLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKD
                     YKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH"
BASE COUNT          267 a          234 c          247 g          182 t
ORIGIN      
        1 atggccccca aattcccaga ctctgtggag gagctccgcg ccgccggcaa tgagagtttc
       61 cgcaacggcc agtacgccga ggcctccgcg ctctacggcc gcgcgctgcg ggtgctgcag
      121 gcgcaaggtt cttcagaccc agaagaagaa agtgttctct actccaaccg agcagcatgt
      181 cacttgaagg atggaaactg cagagactgc atcaaagatt gcacttcagc actggccttg
      241 gttcccttca gcattaagcc cctgctgcgg cgagcatctg cttatgaggc tctggagaag
      301 taccctatgg cctatgttga ctataagact gtgctgcaga ttgatgataa tgtgacgtca
      361 gccgtagaag gcatcaacag aatgaccaga gctctcatgg actcgcttgg gcctgagtgg
      421 cgcctgaagc tgccctcaat ccccttggtg cctgtttcag ctcagaagag gtggaattcc
      481 ttgccttcgg agaaccacaa agagatggct aaaagcaaat ccaaagaaac cacagctaca
      541 aagaacagag tgccttctgc tggggatgtg gagaaagcca gagttctgaa ggaagaaggc
      601 aatgagcttg taaagaaggg aaaccataag aaagctattg agaagtacag tgaaagcctc
      661 ttgtgtagta acctggaatc tgccacgtac agcaacagag cactctgcta tttggtcctg
      721 aagcagtaca cagaagcagt gaaggactgc acagaagccc tcaagctgga tggaaagaac
      781 gtgaaggcat tctacagacg ggctcaagcc cacaaagcac tcaaggacta taaatccagc
      841 tttgcagaca tcagcaacct cctacagatt gagcctagga atggtcctgc acagaagttg
      901 cggcaggaag tgaagcagaa cctacattaa
//