LOCUS       CR456757                 699 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C034D for
            gene VTI1B, vesicle transport through interaction with t-SNAREs
            homolog 1B (yeast); complete cds, incl. stopcodon.
ACCESSION   CR456757
VERSION     CR456757.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 699)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 699)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C034D, ORFNo 861
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C034D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_006370 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..699
                     /db_xref="H-InvDB:HIT000267607"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C034D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..699
                     /codon_start=1
                     /gene="VTI1B"
                     /db_xref="GOA:Q9UEU0"
                     /db_xref="H-InvDB:HIT000267607.11"
                     /db_xref="HGNC:HGNC:17793"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR007705"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="InterPro:IPR038407"
                     /db_xref="PDB:2V8S"
                     /db_xref="UniProtKB/Swiss-Prot:Q9UEU0"
                     /protein_id="CAG33038.1"
                     /translation="MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKL
                     IRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREVRSTPLTA
                     TPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETDQIG
                     SEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLELA
                     ILGGLVYYKFFRSH"
BASE COUNT          210 a          169 c          183 g          137 t
ORIGIN      
        1 atggcctcct ccgccgcctc ctcggagcat ttcgagaagc tgcacgagat cttccgcggc
       61 ctccatgaag acctacaagg ggtgcccgag cggctgctgg ggacggcggg gaccgaagaa
      121 aagaagaaat tgatcaggga ttttgatgaa aagcaacagg aagcaaatga aacgctggca
      181 gagatggagg aggagctacg ttatgcaccc ctgtctttcc gaaaccccat gatgtctaag
      241 cttcgaaact accggaagga ccttgctaaa ctccatcggg aggtgagaag cacacctttg
      301 acagccacac ctggaggccg aggagacatg aaatatggca tatatgctgt agagaatgag
      361 catatgaatc ggctacagtc tcaaagggca atgcttctgc agggcactga aagcctgaac
      421 cgggccaccc aaagtattga acgttctcat cggattgcca cagagactga ccagattggc
      481 tcagaaatca tagaagagct gggggaacaa cgagaccagt tagaacgtac caagagtaga
      541 ctggtaaaca caagtgaaaa cttgagcaaa agtcggaaga ttctccgttc aatgtccaga
      601 aaagtgacaa ccaacaagct gctgctttcc attatcatct tactggagct cgccatcctg
      661 ggaggcctgg tttactacaa attctttcgc agccattaa
//