LOCUS CR456705 1392 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834F043D for gene RXRG, retinoid X receptor, gamma; complete cds, incl. stopcodon. ACCESSION CR456705 VERSION CR456705.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1392) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1392) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834F043D, ORFNo 660 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F043D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_006917 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1392 /db_xref="H-InvDB:HIT000267555" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834F043D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..1392 /codon_start=1 /gene="RXRG" /db_xref="GOA:P48443" /db_xref="H-InvDB:HIT000267555.14" /db_xref="HGNC:HGNC:10479" /db_xref="InterPro:IPR000003" /db_xref="InterPro:IPR000536" /db_xref="InterPro:IPR001628" /db_xref="InterPro:IPR001723" /db_xref="InterPro:IPR013088" /db_xref="InterPro:IPR021780" /db_xref="InterPro:IPR035500" /db_xref="PDB:2GL8" /db_xref="UniProtKB/Swiss-Prot:P48443" /protein_id="CAG32986.1" /translation="MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPS YTDTPVSAPRTLSAVGTPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNV VNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCK GFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRE RAESEAECATSGHEDMPVERILEAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQ LFTLVEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVH RSSAHSAGVGSIFDRVLTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVET LREKVYATLEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT FLMEMLETPLQIT" BASE COUNT 342 a 392 c 354 g 304 t ORIGIN 1 atgtatggaa attattctca cttcatgaag tttcccgcag gctatggagg ctcccctggc 61 cacactggct ctacatccat gagcccatca gcagccttgt ccacagggaa gccaatggac 121 agccacccca gctacacaga taccccagtg agtgccccac ggactctgag tgcagtgggg 181 acccccctca atgccctggg ctctccatat cgagtcatca cctctgccat gggcccaccc 241 tcaggagcac ttgcagcgcc tccaggaatc aacttggttg ccccacccag ctctcagcta 301 aatgtggtca acagtgtcag cagttcagag gacatcaagc ccttaccagg gcttcccggg 361 attggaaaca tgaactaccc atccaccagc cccggatctc tggttaaaca catctgtgcc 421 atctgtggag acagatcctc aggaaagcac tacggggtat acagttgtga aggctgcaaa 481 gggttcttca agaggacgat aaggaaggac ctcatctaca cgtgtcggga taataaagac 541 tgcctcattg acaagcgtca gcgcaaccgc tgccagtact gtcgctatca gaagtgcctt 601 gtcatgggca tgaagaggga agctgtgcaa gaagaaagac agaggagccg agagcgagct 661 gagagtgagg cagaatgtgc taccagtggt catgaagaca tgcctgtgga gaggattcta 721 gaagctgaac ttgctgttga accaaagaca gaatcctatg gtgacatgaa tatggagaac 781 tcgacaaatg accctgttac caacatatgt catgctgctg acaagcagct tttcaccctc 841 gttgaatggg ccaagcgtat tccccacttc tctgacctca ccttggagga ccaggtcatt 901 ttgcttcggg cagggtggaa tgaattgctg attgcctctt tctcccaccg ctcagtttcc 961 gtgcaggatg gcatccttct ggccacgggt ttacatgtcc accggagcag tgcccacagt 1021 gctggggtcg gctccatctt tgacagagtc ctaactgagc tggtttccaa aatgaaagac 1081 atgcagatgg acaagtcgga actgggatgc ctgcgagcca ttgtactctt taacccagat 1141 gccaagggcc tgtccaaccc ctctgaggtg gagactctgc gagagaaggt ttatgccacc 1201 cttgaggcct acaccaagca gaagtatccg gaacagccag gcaggtttgc caagctgctg 1261 ctgcgcctcc cagctctgcg ttccattggc ttgaaatgcc tggagcacct cttcttcttc 1321 aagctcatcg gggacacccc cattgacacc ttcctcatgg agatgttgga gaccccgctg 1381 cagatcactt aa //