LOCUS       CR456705                1392 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F043D for
            gene RXRG, retinoid X receptor, gamma; complete cds, incl.
            stopcodon.
ACCESSION   CR456705
VERSION     CR456705.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1392)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1392)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F043D, ORFNo 660
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F043D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_006917 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1392
                     /db_xref="H-InvDB:HIT000267555"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F043D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1392
                     /codon_start=1
                     /gene="RXRG"
                     /db_xref="GOA:P48443"
                     /db_xref="H-InvDB:HIT000267555.14"
                     /db_xref="HGNC:HGNC:10479"
                     /db_xref="InterPro:IPR000003"
                     /db_xref="InterPro:IPR000536"
                     /db_xref="InterPro:IPR001628"
                     /db_xref="InterPro:IPR001723"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="InterPro:IPR021780"
                     /db_xref="InterPro:IPR035500"
                     /db_xref="PDB:2GL8"
                     /db_xref="UniProtKB/Swiss-Prot:P48443"
                     /protein_id="CAG32986.1"
                     /translation="MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPS
                     YTDTPVSAPRTLSAVGTPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNV
                     VNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCK
                     GFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRE
                     RAESEAECATSGHEDMPVERILEAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQ
                     LFTLVEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVH
                     RSSAHSAGVGSIFDRVLTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVET
                     LREKVYATLEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT
                     FLMEMLETPLQIT"
BASE COUNT          342 a          392 c          354 g          304 t
ORIGIN      
        1 atgtatggaa attattctca cttcatgaag tttcccgcag gctatggagg ctcccctggc
       61 cacactggct ctacatccat gagcccatca gcagccttgt ccacagggaa gccaatggac
      121 agccacccca gctacacaga taccccagtg agtgccccac ggactctgag tgcagtgggg
      181 acccccctca atgccctggg ctctccatat cgagtcatca cctctgccat gggcccaccc
      241 tcaggagcac ttgcagcgcc tccaggaatc aacttggttg ccccacccag ctctcagcta
      301 aatgtggtca acagtgtcag cagttcagag gacatcaagc ccttaccagg gcttcccggg
      361 attggaaaca tgaactaccc atccaccagc cccggatctc tggttaaaca catctgtgcc
      421 atctgtggag acagatcctc aggaaagcac tacggggtat acagttgtga aggctgcaaa
      481 gggttcttca agaggacgat aaggaaggac ctcatctaca cgtgtcggga taataaagac
      541 tgcctcattg acaagcgtca gcgcaaccgc tgccagtact gtcgctatca gaagtgcctt
      601 gtcatgggca tgaagaggga agctgtgcaa gaagaaagac agaggagccg agagcgagct
      661 gagagtgagg cagaatgtgc taccagtggt catgaagaca tgcctgtgga gaggattcta
      721 gaagctgaac ttgctgttga accaaagaca gaatcctatg gtgacatgaa tatggagaac
      781 tcgacaaatg accctgttac caacatatgt catgctgctg acaagcagct tttcaccctc
      841 gttgaatggg ccaagcgtat tccccacttc tctgacctca ccttggagga ccaggtcatt
      901 ttgcttcggg cagggtggaa tgaattgctg attgcctctt tctcccaccg ctcagtttcc
      961 gtgcaggatg gcatccttct ggccacgggt ttacatgtcc accggagcag tgcccacagt
     1021 gctggggtcg gctccatctt tgacagagtc ctaactgagc tggtttccaa aatgaaagac
     1081 atgcagatgg acaagtcgga actgggatgc ctgcgagcca ttgtactctt taacccagat
     1141 gccaagggcc tgtccaaccc ctctgaggtg gagactctgc gagagaaggt ttatgccacc
     1201 cttgaggcct acaccaagca gaagtatccg gaacagccag gcaggtttgc caagctgctg
     1261 ctgcgcctcc cagctctgcg ttccattggc ttgaaatgcc tggagcacct cttcttcttc
     1321 aagctcatcg gggacacccc cattgacacc ttcctcatgg agatgttgga gaccccgctg
     1381 cagatcactt aa
//