LOCUS       CR456701                 660 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834E073D for
            gene BNIP3L, BCL2/adenovirus E1B 19kDa interacting protein 3-like;
            complete cds, incl. stopcodon.
ACCESSION   CR456701
VERSION     CR456701.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 660)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 660)
  AUTHORS   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
  JOURNAL   Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834E073D, ORFNo 645
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E073D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full length
            expression clones generated by RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC (ATG).
            The last base of the last coding triplett has been changed to T,
            which might lead to an amino acid change at the C terminus of the
            polypeptide.
            The stop codon has been set to TAA followed by
            TTAACCCAGCTTTCTT..att.
            Compared to the reference sequence NM_004331 we did not find any
            amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..660
                     /db_xref="H-InvDB:HIT000267551"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834E073D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..660
                     /codon_start=1
                     /gene="BNIP3L"
                     /db_xref="GOA:Q6IBV1"
                     /db_xref="H-InvDB:HIT000267551.12"
                     /db_xref="InterPro:IPR010548"
                     /db_xref="UniProtKB/TrEMBL:Q6IBV1"
                     /protein_id="CAG32982.1"
                     /translation="MSSHLVEPPPPLHNNNNNCEENEQSLPPPAGLNSSWVELPMNSS
                     NGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDG
                     QIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRH
                     PKRSVSLSMRKSGAMKKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSAST
                     Y"
BASE COUNT          188 a          164 c          167 g          141 t
ORIGIN      
        1 atgtcgtccc acctagtcga gccgccgccg cccctgcaca acaacaacaa caactgcgag
       61 gaaaatgagc agtctctgcc cccgccggcc ggcctcaaca gttcctgggt ggagctaccc
      121 atgaacagca gcaatggcaa tgataatggc aatgggaaaa atggggggct ggaacacgta
      181 ccatcctcat cctccatcca caatggagac atggagaaga ttcttttgga tgcacaacat
      241 gaatcaggac agagtagttc cagaggcagt tctcactgtg acagcccttc gccacaagaa
      301 gatgggcaga tcatgtttga tgtggaaatg cacaccagca gggaccatag ctctcagtca
      361 gaagaagaag ttgtagaagg agagaaggaa gtcgaggctt tgaagaaaag tgcggactgg
      421 gtatcagact ggtccagtag acccgaaaac attccaccca aggagttcca cttcagacac
      481 cctaaacgtt ctgtgtcttt aagcatgagg aaaagtggag ccatgaagaa agggggtatt
      541 ttctccgcag aatttctgaa ggtgttcatt ccatctctct tcctttctca tgttttggct
      601 ttggggctag gcatctatat tggaaagcga ctgagcacac cctctgccag cacctattaa
//