LOCUS CR456701 660 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E073D for gene BNIP3L, BCL2/adenovirus E1B 19kDa interacting protein 3-like; complete cds, incl. stopcodon. ACCESSION CR456701 VERSION CR456701.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 660) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 660) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E073D, ORFNo 645 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E073D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_004331 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..660 /db_xref="H-InvDB:HIT000267551" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E073D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..660 /codon_start=1 /gene="BNIP3L" /db_xref="GOA:Q6IBV1" /db_xref="H-InvDB:HIT000267551.12" /db_xref="InterPro:IPR010548" /db_xref="UniProtKB/TrEMBL:Q6IBV1" /protein_id="CAG32982.1" /translation="MSSHLVEPPPPLHNNNNNCEENEQSLPPPAGLNSSWVELPMNSS NGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDG QIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRH PKRSVSLSMRKSGAMKKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSAST Y" BASE COUNT 188 a 164 c 167 g 141 t ORIGIN 1 atgtcgtccc acctagtcga gccgccgccg cccctgcaca acaacaacaa caactgcgag 61 gaaaatgagc agtctctgcc cccgccggcc ggcctcaaca gttcctgggt ggagctaccc 121 atgaacagca gcaatggcaa tgataatggc aatgggaaaa atggggggct ggaacacgta 181 ccatcctcat cctccatcca caatggagac atggagaaga ttcttttgga tgcacaacat 241 gaatcaggac agagtagttc cagaggcagt tctcactgtg acagcccttc gccacaagaa 301 gatgggcaga tcatgtttga tgtggaaatg cacaccagca gggaccatag ctctcagtca 361 gaagaagaag ttgtagaagg agagaaggaa gtcgaggctt tgaagaaaag tgcggactgg 421 gtatcagact ggtccagtag acccgaaaac attccaccca aggagttcca cttcagacac 481 cctaaacgtt ctgtgtcttt aagcatgagg aaaagtggag ccatgaagaa agggggtatt 541 ttctccgcag aatttctgaa ggtgttcatt ccatctctct tcctttctca tgttttggct 601 ttggggctag gcatctatat tggaaagcga ctgagcacac cctctgccag cacctattaa //