LOCUS       CR456552                 385 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens PVALB full length open reading frame (ORF) cDNA clone
            (cDNA clone C22ORF:pGEM.PVALB).
ACCESSION   CR456552
VERSION     CR456552.1
KEYWORDS    CDNA; chromosome 22; ORF.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 385)
  AUTHORS   Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A.,
            Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y.,
            Huckle E.J., Beare D.M., Dunham I.
  TITLE     A genome annotation-driven approach to cloning the human ORFeome
  JOURNAL   Genome Biol. 5(10), R84-R84(2004).
   PUBMED   15461802
REFERENCE   2  (bases 1 to 385)
  AUTHORS   Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A.,
            Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y.,
            Huckle E.J., Beare D.M., Dunham I.
  JOURNAL   Submitted (23-MAR-2006) to the INSDC. Sanger Institute, Hinxton,
            Cambridgeshire, CB10 1SA, UK. E-mail enquiries: c22g@sanger.ac.uk
COMMENT     Sanger Institute name : pGEM.PVALB
            Homo sapiens cDNA sequence. This sequence was generated as part of
            The Wellcome Trust Sanger Institute program to isolate cDNA clones
            representing the full length open reading frame of well annotated
            protein coding genes on human chromosome 22.  For more information
            see http://www.sanger.ac.uk/HGP/Chr22/ORFcloning
FEATURES             Location/Qualifiers
     source          1..385
                     /db_xref="H-InvDB:HIT000267486"
                     /organism="Homo sapiens"
                     /chromosome="22"
                     /lab_host="Mach1"
                     /mol_type="mRNA"
                     /clone="pGEM.PVALB"
                     /db_xref="taxon:9606"
     CDS             17..349
                     /gene="PVALB"
                     /db_xref="GOA:P20472"
                     /db_xref="H-InvDB:HIT000267486.11"
                     /db_xref="HGNC:HGNC:9704"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR008080"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="PDB:1RJV"
                     /db_xref="PDB:1RK9"
                     /db_xref="UniProtKB/Swiss-Prot:P20472"
                     /protein_id="CAG30438.1"
                     /translation="MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDV
                     KKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDE
                     FSTLVAES"
BASE COUNT          106 a           90 c          109 g           80 t
ORIGIN      
        1 ccacccgagt tgcaggatgt cgatgacaga cttgctgaac gctgaggaca tcaagaaggc
       61 ggtgggagcc tttagcgcta ccgactcctt cgaccacaaa aagttcttcc aaatggtcgg
      121 cctgaagaaa aagagtgcgg atgatgtgaa gaaggtgttt cacatgctgg acaaggacaa
      181 aagtggcttc atcgaggagg atgagctggg attcatccta aaaggcttct ccccagatgc
      241 cagagacctg tctgctaaag aaaccaagat gctgatggct gctggagaca aagatgggga
      301 cggcaaaatt ggggttgacg aattctccac tctggtggct gaaagctaag aagcactgac
      361 tgcccctggt cttccacctc tctgc
//