LOCUS CR456552 385 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens PVALB full length open reading frame (ORF) cDNA clone (cDNA clone C22ORF:pGEM.PVALB). ACCESSION CR456552 VERSION CR456552.1 KEYWORDS CDNA; chromosome 22; ORF. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 385) AUTHORS Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. TITLE A genome annotation-driven approach to cloning the human ORFeome JOURNAL Genome Biol. 5(10), R84-R84(2004). PUBMED 15461802 REFERENCE 2 (bases 1 to 385) AUTHORS Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. JOURNAL Submitted (23-MAR-2006) to the INSDC. Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK. E-mail enquiries: c22g@sanger.ac.uk COMMENT Sanger Institute name : pGEM.PVALB Homo sapiens cDNA sequence. This sequence was generated as part of The Wellcome Trust Sanger Institute program to isolate cDNA clones representing the full length open reading frame of well annotated protein coding genes on human chromosome 22. For more information see http://www.sanger.ac.uk/HGP/Chr22/ORFcloning FEATURES Location/Qualifiers source 1..385 /db_xref="H-InvDB:HIT000267486" /organism="Homo sapiens" /chromosome="22" /lab_host="Mach1" /mol_type="mRNA" /clone="pGEM.PVALB" /db_xref="taxon:9606" CDS 17..349 /gene="PVALB" /db_xref="GOA:P20472" /db_xref="H-InvDB:HIT000267486.11" /db_xref="HGNC:HGNC:9704" /db_xref="InterPro:IPR002048" /db_xref="InterPro:IPR008080" /db_xref="InterPro:IPR011992" /db_xref="InterPro:IPR018247" /db_xref="PDB:1RJV" /db_xref="PDB:1RK9" /db_xref="UniProtKB/Swiss-Prot:P20472" /protein_id="CAG30438.1" /translation="MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDV KKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDE FSTLVAES" BASE COUNT 106 a 90 c 109 g 80 t ORIGIN 1 ccacccgagt tgcaggatgt cgatgacaga cttgctgaac gctgaggaca tcaagaaggc 61 ggtgggagcc tttagcgcta ccgactcctt cgaccacaaa aagttcttcc aaatggtcgg 121 cctgaagaaa aagagtgcgg atgatgtgaa gaaggtgttt cacatgctgg acaaggacaa 181 aagtggcttc atcgaggagg atgagctggg attcatccta aaaggcttct ccccagatgc 241 cagagacctg tctgctaaag aaaccaagat gctgatggct gctggagaca aagatgggga 301 cggcaaaatt ggggttgacg aattctccac tctggtggct gaaagctaag aagcactgac 361 tgcccctggt cttccacctc tctgc //