LOCUS CR450359 456 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C023D for gene MGST3, microsomal glutathione S-transferase 3; complete cds; without stopcodon. ACCESSION CR450359 VERSION CR450359.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 456) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 456) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (18-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C023D, ORFNo 584 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C023D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_004528 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..456 /db_xref="H-InvDB:HIT000267268" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C023D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>456 /codon_start=1 /gene="MGST3" /db_xref="GOA:O14880" /db_xref="H-InvDB:HIT000267268.14" /db_xref="HGNC:HGNC:7064" /db_xref="InterPro:IPR001129" /db_xref="InterPro:IPR023352" /db_xref="UniProtKB/Swiss-Prot:O14880" /protein_id="CAG29355.1" /translation="MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMY STDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAY GYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH" BASE COUNT 94 a 115 c 120 g 127 t ORIGIN 1 atggctgtcc tctctaagga atatggtttt gtgcttctaa ctggtgctgc cagctttata 61 atggtggccc acctagccat caatgtttcc aaggcccgca agaagtacaa agtggagtat 121 cctatcatgt acagcacgga ccccgaaaat gggcacatct tcaactgcat tcagcgagcc 181 caccagaaca cgttggaagt gtatcctccc ttcttatttt ttctagctgt tggaggtgtt 241 taccacccgc gtatagcttc tggcctgggc ttggcctgga ttgttggacg agttctttat 301 gcttatggct attacacggg agaacccagc aagcgtagtc gaggagccct ggggtccatc 361 gccctcctgg gcttggtggg cacaactgtg tgctctgctt tccagcatct tggttgggtt 421 aaaagtggct tgggcagtgg acccaaatgc tgccat //