LOCUS CR450357 414 bp mRNA linear HUM 21-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B093D for gene CRABP2, cellular retinoic acid binding protein 2; complete cds; without stopcodon. ACCESSION CR450357 VERSION CR450357.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 414) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 414) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (18-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B093D, ORFNo 574 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B093D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_001878 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..414 /db_xref="H-InvDB:HIT000267266" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B093D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>414 /codon_start=1 /gene="CRABP2" /db_xref="GOA:P29373" /db_xref="H-InvDB:HIT000267266.12" /db_xref="HGNC:HGNC:2339" /db_xref="InterPro:IPR000463" /db_xref="InterPro:IPR000566" /db_xref="InterPro:IPR012674" /db_xref="InterPro:IPR031259" /db_xref="InterPro:IPR031281" /db_xref="PDB:1BLR" /db_xref="PDB:1BM5" /db_xref="PDB:1CBQ" /db_xref="PDB:1CBS" /db_xref="PDB:1XCA" /db_xref="PDB:2CBS" /db_xref="PDB:2FR3" /db_xref="PDB:2FRS" /db_xref="PDB:2FS6" /db_xref="PDB:2FS7" /db_xref="PDB:2G78" /db_xref="PDB:2G79" /db_xref="PDB:2G7B" /db_xref="PDB:3CBS" /db_xref="PDB:3CR6" /db_xref="PDB:3CWK" /db_xref="PDB:3D95" /db_xref="PDB:3D96" /db_xref="PDB:3D97" /db_xref="PDB:3F8A" /db_xref="PDB:3F9D" /db_xref="PDB:3FA6" /db_xref="PDB:3FA7" /db_xref="PDB:3FA8" /db_xref="PDB:3FA9" /db_xref="PDB:3FEK" /db_xref="PDB:3FEL" /db_xref="PDB:3FEN" /db_xref="PDB:3FEP" /db_xref="PDB:3I17" /db_xref="PDB:4I9R" /db_xref="PDB:4I9S" /db_xref="PDB:4M6S" /db_xref="PDB:4M7M" /db_xref="PDB:4QGV" /db_xref="PDB:4QGW" /db_xref="PDB:4QGX" /db_xref="PDB:4YBP" /db_xref="PDB:4YBU" /db_xref="PDB:4YCE" /db_xref="PDB:4YCH" /db_xref="PDB:4YDA" /db_xref="PDB:4YDB" /db_xref="PDB:4YFP" /db_xref="PDB:4YFQ" /db_xref="PDB:4YFR" /db_xref="PDB:4YGG" /db_xref="PDB:4YGH" /db_xref="PDB:4YGZ" /db_xref="PDB:4YH0" /db_xref="PDB:4YKM" /db_xref="PDB:4YKO" /db_xref="PDB:5HZQ" /db_xref="PDB:5OGB" /db_xref="PDB:6HKR" /db_xref="PDB:6MOP" /db_xref="PDB:6MOQ" /db_xref="PDB:6MOR" /db_xref="PDB:6MOV" /db_xref="PDB:6MOX" /db_xref="PDB:6MPK" /db_xref="PDB:6MQI" /db_xref="PDB:6MQJ" /db_xref="PDB:6MQW" /db_xref="PDB:6MQX" /db_xref="PDB:6MQY" /db_xref="PDB:6MQZ" /db_xref="PDB:6MR0" /db_xref="PDB:6NNX" /db_xref="PDB:6NNY" /db_xref="PDB:6NOE" /db_xref="UniProtKB/Swiss-Prot:P29373" /protein_id="CAG29353.1" /translation="MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEI KQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLK GEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE" BASE COUNT 115 a 89 c 133 g 77 t ORIGIN 1 atgcccaact tctctggcaa ctggaaaatc atccgatcgg aaaacttcga ggaattgctc 61 aaagtgctgg gggtgaatgt gatgctgagg aagattgctg tggctgcagc gtccaagcca 121 gcagtggaga tcaaacagga gggggacact ttctacatca aaacctccac caccgtgcgc 181 accacagaga ttaacttcaa ggttggggag gagtttgagg agcagactgt ggatgggagg 241 ccctgtaaga gcctggtgaa atgggagagt gagaataaaa tggtctgtga gcagaagctc 301 ctgaagggag agggccccaa gacctcgtgg accagagaac tgaccaacga tggggaactg 361 atcctgacca tgacggcgga tgacgttgtg tgcaccaggg tctacgtccg agag //