LOCUS CR450342 339 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H0216D for gene TYROBP, TYRO protein tyrosine kinase binding protein; complete cds; without stopcodon. ACCESSION CR450342 VERSION CR450342.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 339) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 339) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (18-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H0216D, ORFNo 429 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H0216D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_003332 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..339 /db_xref="H-InvDB:HIT000267251" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H0216D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>339 /codon_start=1 /gene="TYROBP" /db_xref="GOA:O43914" /db_xref="H-InvDB:HIT000267251.11" /db_xref="HGNC:HGNC:12449" /db_xref="InterPro:IPR026200" /db_xref="PDB:2L34" /db_xref="PDB:2L35" /db_xref="PDB:4WO1" /db_xref="PDB:4WOL" /db_xref="UniProtKB/Swiss-Prot:O43914" /protein_id="CAG29338.1" /translation="MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLA GIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVY SDLNTQRPYYK" BASE COUNT 59 a 100 c 114 g 66 t ORIGIN 1 atggggggac ttgaaccctg cagcaggctc ctgctcctgc ctctcctgct ggctgtaagt 61 ggtctccgtc ctgtccaggc ccaggcccag agcgattgca gttgctctac ggtgagcccg 121 ggcgtgctgg cagggatcgt gatgggagac ctggtgctga cagtgctcat tgccctggcc 181 gtgtacttcc tgggccggct ggtccctcgg gggcgagggg ctgcggaggc agcgacccgg 241 aaacagcgta tcactgagac cgagtcgcct tatcaggagc tccagggtca gaggtcggat 301 gtctacagcg acctcaacac acagaggccg tattacaaa //