LOCUS CR450341 579 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D102D for gene AP3S1, adaptor-related protein complex 3, sigma 1 subunit; complete cds; without stopcodon. ACCESSION CR450341 VERSION CR450341.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 579) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 579) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (18-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D102D, ORFNo 417 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D102D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_001284 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..579 /db_xref="H-InvDB:HIT000267250" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D102D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>579 /codon_start=1 /gene="AP3S1" /db_xref="GOA:Q92572" /db_xref="H-InvDB:HIT000267250.11" /db_xref="HGNC:HGNC:2013" /db_xref="InterPro:IPR000804" /db_xref="InterPro:IPR011012" /db_xref="InterPro:IPR016635" /db_xref="InterPro:IPR022775" /db_xref="UniProtKB/Swiss-Prot:Q92572" /protein_id="CAG29337.1" /translation="MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDE NVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFE NVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPAR AVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK" BASE COUNT 190 a 98 c 124 g 167 t ORIGIN 1 atgatcaagg cgatcctaat cttcaacaac cacgggaagc cgcggctctc caagttctac 61 cagccctaca gtgaagatac acaacagcaa atcatcaggg agactttcca tttggtatct 121 aagagagatg aaaatgtttg taatttccta gaaggaggat tattaattgg aggatctgac 181 aacaaactga tttatagaca ttatgcaacg ttatattttg tcttctgtgt ggattcttca 241 gaaagtgaac ttggcatttt agatctaatt caagtatttg tggaaacatt agacaaatgt 301 tttgaaaatg tctgtgagct ggatttgatt ttccatgtag acaaggttca caatattctt 361 gcagaaatgg tgatgggggg aatggtattg gagacaaata tgaatgagat tgttacacaa 421 attgatgcac aaaataagct ggaaaaatct gaggctggct tagcaggagc tccagcccgt 481 gctgtatcag ctgtaaagaa tatgaatctt cctgagatcc caagaaatat taacattggt 541 gacatcagta taaaagtgcc aaacctgccc tcttttaaa //