LOCUS CR450335 573 bp mRNA linear HUM 18-MAY-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E016D for gene ARHG, ras homolog gene family, member G (rho G); complete cds; without stopcodon. ACCESSION CR450335 VERSION CR450335.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 573) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 573) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (18-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E016D, ORFNo 254 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E016D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_001665 we found amino acid exchange(s) at position (first base of changed triplet): 397(ser->gly) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..573 /db_xref="H-InvDB:HIT000267244" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E016D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>573 /codon_start=1 /gene="ARHG" /db_xref="GOA:Q6ICQ8" /db_xref="H-InvDB:HIT000267244.12" /db_xref="InterPro:IPR001806" /db_xref="InterPro:IPR003578" /db_xref="InterPro:IPR005225" /db_xref="InterPro:IPR027417" /db_xref="UniProtKB/TrEMBL:Q6ICQ8" /protein_id="CAG29331.1" /translation="MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQS AVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVC HHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSAL QQDGVKEVFAEAVRAVLNPTPIKRGRSCILL" BASE COUNT 119 a 184 c 165 g 105 t ORIGIN 1 atgcagagca tcaagtgcgt ggtggtgggt gatggggctg tgggcaagac gtgcctgctc 61 atctgctaca caactaacgc tttccccaaa gagtacatcc ccaccgtgtt cgacaattac 121 agcgcgcaga gcgcagttga cgggcgcaca gtgaacctga acctgtggga cactgcgggc 181 caggaggagt atgaccgcct ccgtacactc tcctaccctc agaccaacgt tttcgtcatc 241 tgtttctcca ttgccagtcc gccgtcctat gagaacgtgc ggcacaagtg gcatccagag 301 gtgtgccacc actgccctga tgtgcccatc ctgctggtgg gcaccaagaa ggacctgaga 361 gcccagcctg acaccctacg gcgcctcaag gagcagggcc aggcgcccat cacaccgcag 421 cagggccagg cactggccaa gcagatccac gctgtgcgct acctcgaatg ctcagccctg 481 caacaggatg gtgtcaagga agtgttcgcc gaggctgtcc gggctgtgct caaccccacg 541 ccgatcaagc gtgggcggtc ctgcatcctc ttg //