LOCUS CR450291 807 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B081D for gene ELA2A, elastase 2A; complete cds; without stopcodon. ACCESSION CR450291 VERSION CR450291.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 807) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 807) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (18-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B081D, ORFNo 69 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B081D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_033440 we found amino acid exchange(s) at position (first base of changed triplet): 592(thr->ala) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..807 /db_xref="H-InvDB:HIT000267200" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B081D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>807 /codon_start=1 /gene="ELA2A" /db_xref="GOA:Q6ICV2" /db_xref="H-InvDB:HIT000267200.13" /db_xref="InterPro:IPR001254" /db_xref="InterPro:IPR001314" /db_xref="InterPro:IPR009003" /db_xref="InterPro:IPR018114" /db_xref="InterPro:IPR033116" /db_xref="UniProtKB/TrEMBL:Q6ICV2" /protein_id="CAG29287.1" /translation="MIRTLLLSTLVAGALSCGDPTYPPYVTRVVGGEEARPNSWPWQV SLQYSSNGKWYHTCGGSLIANSWVLTAAHCISSSRTYRVGLGRHNLYVAESGSLAVSV SKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLPPAGTILPNNYPCYVTGW GRLQTNGAVPDVLQQGRLLVVDYATCSSSAWWGSSVKASMICAGGDGVISSCNGDSGG PLNCQASDGRWQVHGIVSFGSRLGCNYYHKPSVFTRVSNYIDWINSVIANN" BASE COUNT 156 a 254 c 233 g 164 t ORIGIN 1 atgataagga cgctgctgct gtccactttg gtggctggag ccctcagttg tggggacccc 61 acttacccac cttatgtgac tagggtggtt ggcggtgaag aagcgaggcc caacagctgg 121 ccctggcagg tctccctgca gtacagctcc aatggcaagt ggtaccacac ctgcggaggg 181 tccctgatag ccaacagctg ggtcctgacg gctgcccact gcatcagctc ctccaggacc 241 taccgcgtgg ggctgggccg gcacaacctc tacgttgcgg agtccggctc gctggcagtc 301 agtgtctcta agattgtggt gcacaaggac tggaactcca accaaatctc caaagggaac 361 gacattgccc tgctcaaact ggctaacccc gtctccctca ccgacaagat ccagctggcc 421 tgcctccctc ctgccggcac cattctaccc aacaactacc cctgctacgt cacgggctgg 481 ggaaggctgc agaccaacgg ggctgttcct gatgtcctgc agcagggccg gttgctggtt 541 gtggactatg ccacctgctc cagctctgcc tggtggggca gcagcgtgaa agccagtatg 601 atctgtgctg ggggtgatgg cgtgatctcc agctgcaacg gagactctgg cgggccactg 661 aactgtcagg catctgacgg ccggtggcag gtgcacggca tcgtcagctt cgggtcccgc 721 ctcggctgca actactacca caagccctcc gtcttcacgc gggtctccaa ttacatcgac 781 tggatcaatt cggtgattgc aaataac //