LOCUS CR450286 555 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A101D for gene CD99, CD99 antigen; complete cds; without stopcodon. ACCESSION CR450286 VERSION CR450286.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 555) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 555) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (18-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A101D, ORFNo 56 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A101D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_002414 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..555 /db_xref="H-InvDB:HIT000267195_04" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A101D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>555 /codon_start=1 /gene="CD99" /db_xref="GOA:P14209" /db_xref="H-InvDB:HIT000267195_03.4" /db_xref="HGNC:HGNC:7082" /db_xref="InterPro:IPR022078" /db_xref="UniProtKB/Swiss-Prot:P14209" /protein_id="CAG29282.1" /translation="MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIP KKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGG EGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAE QGEVDMESHRNANAEPAVQRTLLEK" BASE COUNT 138 a 145 c 165 g 107 t ORIGIN 1 atggcccgcg gggctgcgct ggcgctgctg ctcttcggcc tgctgggtgt tctggtcgcc 61 gccccggatg gtggtttcga tttatccgat gcccttcctg acaatgaaaa caagaaaccc 121 actgcaatcc ccaagaaacc cagtgctggg gatgactttg acttaggaga tgctgttgtt 181 gatggagaaa atgacgaccc acgaccaccg aacccaccca aaccgatgcc aaatccaaac 241 cccaaccacc ctagttcctc cggtagcttt tcagatgctg accttgcgga tggcgtttca 301 ggtggagaag gaaaaggagg cagtgatggt ggaggcagcc acaggaaaga aggggaagag 361 gccgacgccc caggcgtgat ccccgggatt gtgggggctg tcgtggtcgc cgtggctgga 421 gccatctcta gcttcattgc ttaccagaaa aagaagctat gcttcaaaga aaatgcagaa 481 caaggggagg tggacatgga gagccaccgg aatgccaacg cagagccagc tgttcagcgt 541 actcttttag agaaa //