LOCUS CR407692 1296 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E053D for gene CCNA2, cyclin A2 complete cds, without stopcodon. ACCESSION CR407692 VERSION CR407692.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1296) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1296) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E053D, ORFNo 643 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E053D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_001237 we found amino acid exchange(s) at position (first base of changed triplet): 466(his->arg) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1296 /db_xref="H-InvDB:HIT000267189" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E053D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>1296 /codon_start=1 /gene="CCNA2" /db_xref="GOA:P20248" /db_xref="H-InvDB:HIT000267189.11" /db_xref="HGNC:HGNC:1578" /db_xref="InterPro:IPR004367" /db_xref="InterPro:IPR006671" /db_xref="InterPro:IPR013763" /db_xref="InterPro:IPR032447" /db_xref="InterPro:IPR036915" /db_xref="InterPro:IPR039361" /db_xref="PDB:1E9H" /db_xref="PDB:1FIN" /db_xref="PDB:1FVV" /db_xref="PDB:1GY3" /db_xref="PDB:1H1P" /db_xref="PDB:1H1Q" /db_xref="PDB:1H1R" /db_xref="PDB:1H1S" /db_xref="PDB:1H24" /db_xref="PDB:1H25" /db_xref="PDB:1H26" /db_xref="PDB:1H27" /db_xref="PDB:1H28" /db_xref="PDB:1JST" /db_xref="PDB:1JSU" /db_xref="PDB:1OGU" /db_xref="PDB:1OI9" /db_xref="PDB:1OIU" /db_xref="PDB:1OIY" /db_xref="PDB:1OKV" /db_xref="PDB:1OKW" /db_xref="PDB:1OL1" /db_xref="PDB:1OL2" /db_xref="PDB:1P5E" /db_xref="PDB:1PKD" /db_xref="PDB:1QMZ" /db_xref="PDB:1URC" /db_xref="PDB:1VYW" /db_xref="PDB:2BKZ" /db_xref="PDB:2BPM" /db_xref="PDB:2C4G" /db_xref="PDB:2C5N" /db_xref="PDB:2C5O" /db_xref="PDB:2C5V" /db_xref="PDB:2C5X" /db_xref="PDB:2C6T" /db_xref="PDB:2CCH" /db_xref="PDB:2CCI" /db_xref="PDB:2CJM" /db_xref="PDB:2I40" /db_xref="PDB:2IW6" /db_xref="PDB:2IW8" /db_xref="PDB:2IW9" /db_xref="PDB:2UUE" /db_xref="PDB:2UZB" /db_xref="PDB:2UZD" /db_xref="PDB:2UZE" /db_xref="PDB:2UZL" /db_xref="PDB:2V22" /db_xref="PDB:2WEV" /db_xref="PDB:2WFY" /db_xref="PDB:2WHB" /db_xref="PDB:2WIH" /db_xref="PDB:2WIP" /db_xref="PDB:2WMA" /db_xref="PDB:2WMB" /db_xref="PDB:2WPA" /db_xref="PDB:2WXV" /db_xref="PDB:2X1N" /db_xref="PDB:3EID" /db_xref="PDB:3EJ1" /db_xref="PDB:3EOC" /db_xref="PDB:3F5X" /db_xref="PDB:4BCK" /db_xref="PDB:4BCM" /db_xref="PDB:4BCN" /db_xref="PDB:4BCP" /db_xref="PDB:4CFM" /db_xref="PDB:4CFN" /db_xref="PDB:4CFU" /db_xref="PDB:4CFV" /db_xref="PDB:4CFW" /db_xref="PDB:4CFX" /db_xref="PDB:4EOI" /db_xref="PDB:4EOJ" /db_xref="PDB:4EOK" /db_xref="PDB:4EOL" /db_xref="PDB:4EOM" /db_xref="PDB:4EON" /db_xref="PDB:4EOO" /db_xref="PDB:4EOP" /db_xref="PDB:4EOQ" /db_xref="PDB:4EOR" /db_xref="PDB:4EOS" /db_xref="PDB:4FX3" /db_xref="PDB:5CYI" /db_xref="PDB:5IF1" /db_xref="PDB:5LMK" /db_xref="PDB:5NEV" /db_xref="PDB:6ATH" /db_xref="PDB:6GVA" /db_xref="UniProtKB/Swiss-Prot:P20248" /protein_id="CAG28620.1" /translation="MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQP RTRAALAVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIH VDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPRTMDM SIVLEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWL VEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVA EFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAM FLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLM DLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL" BASE COUNT 391 a 299 c 301 g 305 t ORIGIN 1 atgttgggca actctgcgcc ggggcctgcg acccgcgagg cgggctcggc gctgctagca 61 ttgcagcaga cggcgctcca agaggaccag gagaatatca acccggaaaa ggcagcgccc 121 gtccaacaac cgcggacccg ggccgcgctg gcggtactga agtccgggaa cccgcggggt 181 ctagcgcagc agcagaggcc gaagacgaga cgggttgcac cccttaagga tcttcctgta 241 aatgatgagc atgtcaccgt tcctccttgg aaagcaaaca gtaaacagcc tgcgttcacc 301 attcatgtgg atgaagcaga aaaagaagct cagaagaagc cagctgaatc tcaaaaaata 361 gagcgtgaag atgccctggc ttttaattca gccattagtt tacctggacc cagaaaacca 421 ttggtccctc ttgattatcc aatggatggt agttttgagt caccacgtac tatggacatg 481 tcaattgtat tagaagatga aaagccagtg agtgttaatg aagtaccaga ctaccatgag 541 gatattcaca cataccttag ggaaatggag gttaaatgta aacctaaagt gggttacatg 601 aagaaacagc cagacatcac taacagtatg agagctatcc tcgtggactg gttagttgaa 661 gtaggagaag aatataaact acagaatgag accctgcatt tggctgtgaa ctacattgat 721 aggttcctgt cttccatgtc agtgctgagg ggaaaacttc agcttgtggg cactgctgct 781 atgctgttag cctcaaagtt tgaagaaata taccccccag aagtagcaga gtttgtgtac 841 attacagatg atacctacac caagaaacaa gttctgagaa tggagcatct agttttgaaa 901 gtccttactt ttgacttagc tgctccaaca gtaaatcagt ttcttaccca atactttctg 961 catcagcagc ctgcaaactg caaagttgaa agtttagcaa tgtttttggg agaattaagt 1021 ttgatagatg ctgacccata cctcaagtat ttgccatcag ttattgctgg agctgccttt 1081 catttagcac tctacacagt cacgggacaa agctggcctg aatcattaat acgaaagact 1141 ggatataccc tggaaagtct taagccttgt ctcatggacc ttcaccagac ctacctcaaa 1201 gcaccacagc atgcacaaca gtcaataaga gaaaagtaca aaaattcaaa gtatcatggt 1261 gtttctctcc tcaacccacc agagacacta aatctg //