LOCUS CR407678 549 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G026D for gene MFAP2, microfibrillar-associated protein 2 complete cds, without stopcodon. ACCESSION CR407678 VERSION CR407678.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 549) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 549) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G026D, ORFNo 602 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G026D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence BC015039 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..549 /db_xref="H-InvDB:HIT000267175" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G026D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>549 /codon_start=1 /gene="MFAP2" /db_xref="GOA:P55001" /db_xref="H-InvDB:HIT000267175.12" /db_xref="HGNC:HGNC:7033" /db_xref="InterPro:IPR003582" /db_xref="InterPro:IPR008673" /db_xref="UniProtKB/Swiss-Prot:P55001" /protein_id="CAG28606.1" /translation="MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDN PDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQY PCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKC GVMASSGLCQSVAASCARSCGSC" BASE COUNT 117 a 182 c 141 g 109 t ORIGIN 1 atgagagctg cctacctctt cctgctattc ctgcctgcag gcttgctggc tcagggccag 61 tatgacctgg acccgctgcc gccgttccct gaccacgtcc agtacaccca ctatagcgac 121 cagatcgaca acccagacta ctatgattat caagaggtga ctcctcggcc ctccgaggaa 181 cagttccagt tccagtccca gcagcaagtc caacaggaag tcatcccagc cccaacccca 241 gaaccaggaa atgcagagct ggagcccaca gagcctgggc ctcttgactg ccgtgaggaa 301 cagtacccgt gcacccgcct ctactccata cacaggcctt gcaaacagtg tctcaacgag 361 gtctgcttct acagcctccg ccgtgtgtac gtcattaaca aggagatctg tgttcgtaca 421 gtgtgtgccc acgaggagct cctccgagct gacctctgtc gggacaagtt ctccaaatgt 481 ggcgtgatgg ccagcagcgg cctgtgccaa tccgtggcgg cctcctgtgc caggagctgt 541 gggagctgc //