LOCUS CR407676 1077 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834C053D for gene DCN, decorin complete cds, without stopcodon. ACCESSION CR407676 VERSION CR407676.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1077) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 1077) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834C053D, ORFNo 593 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C053D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_001920 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..1077 /db_xref="H-InvDB:HIT000267173" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834C053D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>1077 /codon_start=1 /gene="DCN" /db_xref="GOA:Q6FH10" /db_xref="H-InvDB:HIT000267173.12" /db_xref="InterPro:IPR000372" /db_xref="InterPro:IPR001611" /db_xref="InterPro:IPR003591" /db_xref="InterPro:IPR016352" /db_xref="InterPro:IPR028549" /db_xref="InterPro:IPR032675" /db_xref="UniProtKB/TrEMBL:Q6FH10" /protein_id="CAG28604.1" /translation="MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDR DFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFK NLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHEN EITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQG LPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHL DNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPV QYWEIQPSTFRCVYVRSAIQLGNYK" BASE COUNT 304 a 267 c 236 g 270 t ORIGIN 1 atgaaggcca ctatcatcct ccttctgctt gcacaagttt cctgggctgg accgtttcaa 61 cagagaggct tatttgactt tatgctagaa gatgaggctt ctgggatagg cccagaagtt 121 cctgatgacc gcgacttcga gccctcccta ggcccagtgt gccccttccg ctgtcaatgc 181 catcttcgag tggtccagtg ttctgatttg ggtctggaca aagtgccaaa ggatcttccc 241 cctgacacaa ctctgctaga cctgcaaaac aacaaaataa ccgaaatcaa agatggagac 301 tttaagaacc tgaagaacct tcacgcattg attcttgtca acaataaaat tagcaaagtt 361 agtcctggag catttacacc tttggtgaag ttggaacgac tttatctgtc caagaatcag 421 ctgaaggaat tgccagaaaa aatgcccaaa actcttcagg agctgcgtgc ccatgagaat 481 gagatcacca aagtgcgaaa agttactttc aatggactga accagatgat tgtcatagaa 541 ctgggcacca atccgctgaa gagctcagga attgaaaatg gggctttcca gggaatgaag 601 aagctctcct acatccgcat tgctgatacc aatatcacca gcattcctca aggtcttcct 661 ccttccctta cggaattaca tcttgatggc aacaaaatca gcagagttga tgcagctagc 721 ctgaaaggac tgaataattt ggctaagttg ggattgagtt tcaacagcat ctctgctgtt 781 gacaatggct ctctggccaa cacgcctcat ctgagggagc ttcacttgga caacaacaag 841 cttaccagag tacctggtgg gctggcagag cataagtaca tccaggttgt ctaccttcat 901 aacaacaata tctctgtagt tggatcaagt gacttctgcc cacctggaca caacaccaaa 961 aaggcttctt attcgggtgt gagtcttttc agcaacccgg tccagtactg ggagatacag 1021 ccatccacct tcagatgtgt ctacgtgcgc tctgccattc aactcggaaa ctataag //