LOCUS CR407669 648 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B053D for gene RAB11A, RAB11A, member RAS oncogene family complete cds, without stopcodon. ACCESSION CR407669 VERSION CR407669.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 648) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 648) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B053D, ORFNo 565 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B053D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_004663 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..648 /db_xref="H-InvDB:HIT000267166" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B053D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>648 /codon_start=1 /gene="RAB11A" /db_xref="GOA:P62491" /db_xref="H-InvDB:HIT000267166.13" /db_xref="HGNC:HGNC:9760" /db_xref="InterPro:IPR001806" /db_xref="InterPro:IPR005225" /db_xref="InterPro:IPR027417" /db_xref="PDB:1OIV" /db_xref="PDB:1OIW" /db_xref="PDB:1OIX" /db_xref="PDB:1YZK" /db_xref="PDB:2D7C" /db_xref="PDB:2GZD" /db_xref="PDB:2GZH" /db_xref="PDB:2HV8" /db_xref="PDB:4C4P" /db_xref="PDB:4D0L" /db_xref="PDB:4D0M" /db_xref="PDB:4LWZ" /db_xref="PDB:4LX0" /db_xref="PDB:4UJ3" /db_xref="PDB:4UJ4" /db_xref="PDB:4UJ5" /db_xref="PDB:5C46" /db_xref="PDB:5C4G" /db_xref="PDB:5EUQ" /db_xref="PDB:5EZ5" /db_xref="PDB:5FBL" /db_xref="PDB:5FBQ" /db_xref="PDB:5FBR" /db_xref="PDB:5FBV" /db_xref="PDB:5FBW" /db_xref="PDB:5JCZ" /db_xref="PDB:6DJL" /db_xref="PDB:6IXV" /db_xref="UniProtKB/Swiss-Prot:P62491" /protein_id="CAG28597.1" /translation="MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTI GVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENV ERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTN VEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI" BASE COUNT 208 a 125 c 148 g 167 t ORIGIN 1 atgggcaccc gcgacgacga gtacgactac ctctttaaag ttgtccttat tggagattct 61 ggtgttggaa agagtaatct cctgtctcga tttactcgaa atgagtttaa tctggaaagc 121 aagagcacca ttggagtaga gtttgcaaca agaagcatcc aggttgatgg aaaaacaata 181 aaggcacaga tatgggacac agcagggcaa gagcgatatc gagctataac atcagcatat 241 tatcgtggag ctgtaggtgc cttattggtt tatgacattg ctaaacatct cacatatgaa 301 aatgtagagc gatggctgaa agaactgaga gatcatgctg atagtaacat tgttatcatg 361 cttgtgggca ataagagtga tctacgtcat ctcagggcag ttcctacaga tgaagcaaga 421 gcttttgcag aaaagaatgg tttgtcattc attgaaactt cggccctaga ctctacaaat 481 gtagaagctg cttttcagac aattttaaca gagatttacc gcattgtttc tcagaagcaa 541 atgtcagaca gacgcgaaaa tgacatgtct ccaagcaaca atgtggttcc tattcatgtt 601 ccaccaacca ctgaaaacaa gccaaaggtg cagtgctgtc agaacatc //