LOCUS CR407665 315 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G017D for gene TXN, thioredoxin complete cds, without stopcodon. ACCESSION CR407665 VERSION CR407665.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 315) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 315) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G017D, ORFNo 544 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G017D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence BC054866 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..315 /db_xref="H-InvDB:HIT000267162" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G017D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>315 /codon_start=1 /gene="TXN" /db_xref="GOA:P10599" /db_xref="H-InvDB:HIT000267162.12" /db_xref="HGNC:HGNC:12435" /db_xref="InterPro:IPR005746" /db_xref="InterPro:IPR013766" /db_xref="InterPro:IPR017937" /db_xref="InterPro:IPR036249" /db_xref="PDB:1AIU" /db_xref="PDB:1AUC" /db_xref="PDB:1CQG" /db_xref="PDB:1CQH" /db_xref="PDB:1ERT" /db_xref="PDB:1ERU" /db_xref="PDB:1ERV" /db_xref="PDB:1ERW" /db_xref="PDB:1M7T" /db_xref="PDB:1MDI" /db_xref="PDB:1MDJ" /db_xref="PDB:1MDK" /db_xref="PDB:1TRS" /db_xref="PDB:1TRU" /db_xref="PDB:1TRV" /db_xref="PDB:1TRW" /db_xref="PDB:1W1C" /db_xref="PDB:1W1E" /db_xref="PDB:2HSH" /db_xref="PDB:2HXK" /db_xref="PDB:2IFQ" /db_xref="PDB:2IIY" /db_xref="PDB:3E3E" /db_xref="PDB:3KD0" /db_xref="PDB:3M9J" /db_xref="PDB:3M9K" /db_xref="PDB:3QFA" /db_xref="PDB:3QFB" /db_xref="PDB:3TRX" /db_xref="PDB:4LL1" /db_xref="PDB:4LL4" /db_xref="PDB:4OO4" /db_xref="PDB:4OO5" /db_xref="PDB:4POK" /db_xref="PDB:4POL" /db_xref="PDB:4POM" /db_xref="PDB:4PUF" /db_xref="PDB:4TRX" /db_xref="PDB:5DQY" /db_xref="UniProtKB/Swiss-Prot:P10599" /protein_id="CAG28593.1" /translation="MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHS LSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATIN ELV" BASE COUNT 90 a 57 c 79 g 89 t ORIGIN 1 atggtgaagc agatcgagag caagactgct tttcaggaag ccttggacgc tgcaggtgat 61 aaacttgtag tagttgactt ctcagccacg tggtgtgggc cttgcaaaat gatcaagcct 121 ttctttcatt ccctctctga aaagtattcc aacgtgatat tccttgaagt agatgtggat 181 gactgtcagg atgttgcttc agagtgtgaa gtcaaatgca tgccaacatt ccagtttttt 241 aagaagggac aaaaggtggg tgaattttct ggagccaata aggaaaagct tgaagccacc 301 attaatgaat tagtc //