LOCUS CR407657 858 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H092D for gene CAPZA1, capping protein (actin filament) muscle Z-line, alpha 1 complete cds, without stopcodon. ACCESSION CR407657 VERSION CR407657.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 858) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 858) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H092D, ORFNo 523 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H092D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence BC000144 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..858 /db_xref="H-InvDB:HIT000267154" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H092D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>858 /codon_start=1 /gene="CAPZA1" /db_xref="GOA:P52907" /db_xref="H-InvDB:HIT000267154.13" /db_xref="HGNC:HGNC:1488" /db_xref="InterPro:IPR002189" /db_xref="InterPro:IPR017865" /db_xref="InterPro:IPR037282" /db_xref="InterPro:IPR042276" /db_xref="InterPro:IPR042489" /db_xref="PDB:1MQ1" /db_xref="PDB:1MWN" /db_xref="UniProtKB/Swiss-Prot:P52907" /protein_id="CAG28585.1" /translation="MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDN LLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLR KEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIES HQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSLTV SNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILS YKIGKEMQNA" BASE COUNT 279 a 174 c 194 g 211 t ORIGIN 1 atggccgact tcgatgatcg tgtgtcggat gaggagaagg tacgcatagc tgctaaattc 61 atcactcatg cacccccagg ggaatttaat gaagtattca atgacgttcg gctactactt 121 aataatgaca atctcctcag ggaaggggca gcacatgcat ttgcccagta taacatggat 181 cagttcacgc ctgtgaagat agaaggatat gaagatcagg tcttaattac agagcacggt 241 gacctgggta atagcagatt tttagatcca agaaacaaaa tttcctttaa atttgaccac 301 ttacggaaag aagcaagtga cccccagcca gaagaagcag atggaggtct gaagtcttgg 361 agagaatcct gtgacagtgc tttaagagcc tatgtgaaag accattattc caacggcttc 421 tgtactgttt atgctaaaac tatcgatggg caacagacta ttattgcatg tattgaaagc 481 caccagtttc agcctaaaaa cttctggaat ggtcgttgga gatcagagtg gaagttcacc 541 atcacaccac ctacagccca ggtggttggc gtgcttaaga ttcaggttca ctattatgaa 601 gatggcaatg ttcagttggt tagtcataaa gatgtacagg attcactaac tgtttcgaat 661 gaagcccaaa ctgccaagga gtttattaaa atcatagaga atgcagaaaa tgagtatcag 721 acagcaatta gtgaaaacta tcaaacaatg tcagatacca cattcaaggc cttgcgccgg 781 cagcttccag ttacccgcac caaaatcgac tggaacaaga tactcagcta caagattggc 841 aaagaaatgc agaatgct //