LOCUS CR407656 666 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H082D for gene GSTA1, glutathione S-transferase A1 complete cds, without stopcodon. ACCESSION CR407656 VERSION CR407656.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 666) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 666) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H082D, ORFNo 521 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H082D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_145740 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..666 /db_xref="H-InvDB:HIT000267153" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H082D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>666 /codon_start=1 /gene="GSTA1" /db_xref="GOA:P08263" /db_xref="H-InvDB:HIT000267153.12" /db_xref="HGNC:HGNC:4626" /db_xref="InterPro:IPR003080" /db_xref="InterPro:IPR004045" /db_xref="InterPro:IPR004046" /db_xref="InterPro:IPR010987" /db_xref="InterPro:IPR036249" /db_xref="InterPro:IPR036282" /db_xref="InterPro:IPR040079" /db_xref="PDB:1GSD" /db_xref="PDB:1GSE" /db_xref="PDB:1GSF" /db_xref="PDB:1GUH" /db_xref="PDB:1K3L" /db_xref="PDB:1K3O" /db_xref="PDB:1K3Y" /db_xref="PDB:1LBK" /db_xref="PDB:1PKW" /db_xref="PDB:1PKZ" /db_xref="PDB:1PL1" /db_xref="PDB:1PL2" /db_xref="PDB:1USB" /db_xref="PDB:1XWG" /db_xref="PDB:1YDK" /db_xref="PDB:2R3X" /db_xref="PDB:2R6K" /db_xref="PDB:3I69" /db_xref="PDB:3I6A" /db_xref="PDB:3IK9" /db_xref="PDB:3KTL" /db_xref="PDB:3L0H" /db_xref="PDB:3Q74" /db_xref="PDB:3U6V" /db_xref="PDB:3ZFB" /db_xref="PDB:3ZFL" /db_xref="PDB:4HJ2" /db_xref="PDB:5JCU" /db_xref="PDB:5LCZ" /db_xref="PDB:5LD0" /db_xref="PDB:6ATO" /db_xref="PDB:6ATP" /db_xref="PDB:6ATQ" /db_xref="PDB:6ATR" /db_xref="UniProtKB/Swiss-Prot:P08263" /protein_id="CAG28584.1" /translation="MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKL RNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADL GEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHL VELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARK IFRF" BASE COUNT 205 a 145 c 161 g 155 t ORIGIN 1 atggcagaga agcccaagct ccactacttc aatgcacggg gcagaatgga gtccacccgg 61 tggctcctgg ctgcagctgg agtagagttt gaagagaaat ttataaaatc tgcagaagat 121 ttggacaagt taagaaatga tggatatttg atgttccagc aagtgccaat ggttgagatt 181 gatgggatga agctggtgca gaccagagcc attctcaact acattgccag caaatacaac 241 ctctatggga aagacataaa ggagagagcc ctgattgata tgtatataga aggtatagca 301 gatttgggtg aaatgatcct ccttctgccc gtatgtccac ctgaggaaaa agatgccaag 361 cttgccttga tcaaagagaa aataaaaaat cgctacttcc ctgcctttga aaaagtctta 421 aagagccatg gacaagacta ccttgttggc aacaagctga gccgggctga cattcatctg 481 gtggaacttc tctactacgt cgaggagctt gactccagtc ttatctccag cttccctctg 541 ctgaaggccc tgaaaaccag aatcagcaac ctgcccacag tgaagaagtt tctacagcct 601 ggcagcccaa ggaagcctcc catggatgag aaatctttag aagaagcaag gaagattttc 661 aggttt //