LOCUS CR407653 738 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834H042D for gene TFAM, transcription factor A, mitochondrial complete cds, without stopcodon. ACCESSION CR407653 VERSION CR407653.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 738) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 738) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834H042D, ORFNo 510 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834H042D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_003201 we found amino acid exchange(s) at position (first base of changed triplet): 34(ser->thr) 106(val->ala) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..738 /db_xref="H-InvDB:HIT000267150" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834H042D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>738 /codon_start=1 /gene="TFAM" /db_xref="GOA:Q6LES8" /db_xref="H-InvDB:HIT000267150.13" /db_xref="InterPro:IPR009071" /db_xref="InterPro:IPR036910" /db_xref="UniProtKB/TrEMBL:Q6LES8" /protein_id="CAG28581.1" /translation="MAFLRSMWGVLTALGRSGAELCTGCGSRLRSPFSFAYLPRWFSS VLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDA YRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRS AYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSW EEQMIEVGRKDLLRRTIKKQRKYGAEEC" BASE COUNT 264 a 128 c 170 g 176 t ORIGIN 1 atggcgtttc tccgaagcat gtggggcgtg ctgactgccc tgggaaggtc tggagcagag 61 ctgtgcaccg gctgtggaag tcgactgcgc tcccccttca gttttgcgta tttaccgagg 121 tggttttcat ctgtcttggc aagttgtcca aagaaacctg taagttctta ccttcgattt 181 tctaaagaac aactacccat atttaaagct cagaacccag atgcaaaaac tacagaacta 241 attagaagaa ttgcccagcg ttggagggaa cttcctgatt caaagaaaaa aatatatcaa 301 gatgcttata gggcggagtg gcaggtatat aaagaagaga taagcagatt taaagaacag 361 ctaactccaa gtcagattat gtctttggaa aaagaaatca tggacaaaca tttaaaaagg 421 aaagctatga caaaaaaaaa agagttaaca ctgcttggaa aaccaaaaag acctcgttca 481 gcttataacg tttatgtagc tgaaagattc caagaagcta agggtgattc accgcaggaa 541 aagctgaaga ctgtaaagga aaactggaaa aatctgtctg actctgaaaa ggaattatat 601 attcagcatg ctaaagagga cgaaactcgt tatcataatg aaatgaagtc ttgggaagaa 661 caaatgattg aagttggacg aaaggatctt ctacgtcgca caataaagaa acaacgaaaa 721 tatggtgctg aggagtgt //