LOCUS CR407648 969 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G042D for gene ANXA3, annexin A3 complete cds, without stopcodon. ACCESSION CR407648 VERSION CR407648.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 969) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 969) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G042D, ORFNo 490 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G042D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_005139 we found amino acid exchange(s) at position (first base of changed triplet): 103(gly->arg) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..969 /db_xref="H-InvDB:HIT000267145" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G042D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>969 /codon_start=1 /gene="ANXA3" /db_xref="GOA:P12429" /db_xref="H-InvDB:HIT000267145.13" /db_xref="HGNC:HGNC:541" /db_xref="InterPro:IPR001464" /db_xref="InterPro:IPR002390" /db_xref="InterPro:IPR018252" /db_xref="InterPro:IPR018502" /db_xref="InterPro:IPR037104" /db_xref="PDB:1AII" /db_xref="PDB:1AXN" /db_xref="UniProtKB/Swiss-Prot:P12429" /protein_id="CAG28576.1" /translation="MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIRTDEKMLISI LTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKS MKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLA DGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRN ISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIM VSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD" BASE COUNT 317 a 178 c 236 g 238 t ORIGIN 1 atggcatcta tctgggttgg acaccgagga acagtaagag attatccaga ctttagccca 61 tcagtggatg ctgaagctat tcagaaagca atcagaggaa ttagaactga tgagaaaatg 121 ctcatcagca ttctgactga gaggtcaaat gcacagcggc agctgattgt taaggaatat 181 caagcagcat atggaaagga gctgaaagat gacttgaagg gtgatctctc tggccacttt 241 gagcatctca tggtggccct agtgactcca ccagcagtct ttgatgcaaa gcagctaaag 301 aaatccatga agggcgcggg aacaaacgaa gatgccttga ttgaaatctt aactaccagg 361 acaagcaggc aaatgaagga tatctctcaa gcctattata cagtatacaa gaagagtctt 421 ggagatgaca ttagttccga aacatctggt gacttccgga aagctctgtt gactttggca 481 gatggcagaa gagatgaaag tctgaaagtg gatgagcatc tggccaaaca agatgcccag 541 attctctata aagctggtga gaacagatgg ggcacggatg aagacaaatt cactgagatc 601 ctgtgtttaa ggagctttcc tcaattaaaa ctaacatttg atgaatacag aaatatcagc 661 caaaaggaca ttgtggacag cataaaagga gaattatctg ggcattttga agacttactg 721 ttggccatag ttaattgtgt gaggaacacg ccggcctttt tagccgaaag actgcatcga 781 gccttgaagg gtattggaac tgatgagttt actctgaacc gaataatggt gtccagatca 841 gaaattgacc ttttggacat tcgaacagag ttcaagaagc attatggcta ttccctatat 901 tcagcaatta aatcggatac ttctggagac tatgaaatca cactcttaaa aatctgtggt 961 ggagatgac //