LOCUS CR407634 456 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834E032D for gene UBE2B, ubiquitin-conjugating enzyme E2B (RAD6 homolog) complete cds, without stopcodon. ACCESSION CR407634 VERSION CR407634.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 456) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 456) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834E032D, ORFNo 434 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834E032D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_003337 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..456 /db_xref="H-InvDB:HIT000267131" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834E032D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>456 /codon_start=1 /gene="UBE2B" /db_xref="GOA:P63146" /db_xref="H-InvDB:HIT000267131.13" /db_xref="HGNC:HGNC:12473" /db_xref="InterPro:IPR000608" /db_xref="InterPro:IPR016135" /db_xref="InterPro:IPR023313" /db_xref="PDB:1JAS" /db_xref="PDB:1NXA" /db_xref="PDB:2Y4W" /db_xref="PDB:2YB6" /db_xref="PDB:2YBF" /db_xref="UniProtKB/Swiss-Prot:P63146" /protein_id="CAG28562.1" /translation="MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPE GTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDV SSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS" BASE COUNT 145 a 93 c 99 g 119 t ORIGIN 1 atgtcgaccc cggcccggag gaggctcatg cgggatttca agcggttaca agaggaccca 61 cctgtgggtg tcagtggcgc accatctgaa aacaacatca tgcagtggaa tgcagttata 121 tttggaccag aagggacacc ttttgaagat ggtactttta aactagtaat agaattttct 181 gaagaatatc caaataaacc accaactgtt aggtttttat ccaaaatgtt tcatccaaat 241 gtgtatgctg atggtagcat atgtttagat atccttcaga atcgatggag tccaacatat 301 gacgtatctt ctatcttaac atcaattcag tctctgctgg atgaaccgaa tcctaacagt 361 ccagccaata gccaggcagc acagctttat caggaaaaca aacgagaata tgagaaaaga 421 gtttcggcca ttgttgaaca aagctggaat gattca //