LOCUS CR407629 465 bp mRNA linear HUM 10-MAY-2004 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834D062D for gene MGST1, microsomal glutathione S-transferase 1 complete cds, without stopcodon. ACCESSION CR407629 VERSION CR407629.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 465) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 465) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834D062D, ORFNo 412 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834D062D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_145764 we found amino acid exchange(s) at position (first base of changed triplet): 220(arg->lys) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..465 /db_xref="H-InvDB:HIT000267126" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834D062D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>465 /codon_start=1 /gene="MGST1" /db_xref="GOA:Q6LET6" /db_xref="H-InvDB:HIT000267126.13" /db_xref="InterPro:IPR001129" /db_xref="InterPro:IPR023352" /db_xref="InterPro:IPR040162" /db_xref="UniProtKB/TrEMBL:Q6LET6" /protein_id="CAG28557.1" /translation="MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVF ANPEDCVAFGKGENAKKYLRTDDRVERVRKAHLNDLENIIPFLGIGLLYSLSGPDPST AILHFRLFVGARIYHTIAYLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL" BASE COUNT 131 a 102 c 93 g 139 t ORIGIN 1 atggttgacc tcacccaggt aatggatgat gaagtattca tggcttttgc atcctatgca 61 acaattattc tttcaaaaat gatgcttatg agtactgcaa ctgcattcta tagattgaca 121 agaaaggttt ttgccaatcc agaagactgt gtagcatttg gcaaaggaga aaatgccaag 181 aagtatcttc gaacagatga cagagtagaa cgtgtacgca aagcccacct gaatgacctt 241 gaaaatatta ttccatttct tggaattggc ctcctgtatt ccttgagtgg tcccgacccc 301 tctacagcca tcctgcactt cagactattt gtcggagcac ggatctacca caccattgca 361 tatttgacac cccttcccca gccaaataga gctttgagtt tttttgttgg atatggagtt 421 actctttcca tggcttacag gttgctgaaa agtaaattgt acctg //