LOCUS CR407618 243 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A1116D for gene NDUFA4, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa complete cds, without stopcodon. ACCESSION CR407618 VERSION CR407618.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 243) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 243) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A1116D, ORFNo 267 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A1116D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_002489 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..243 /db_xref="H-InvDB:HIT000267115" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A1116D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>243 /codon_start=1 /gene="NDUFA4" /db_xref="GOA:O00483" /db_xref="H-InvDB:HIT000267115.13" /db_xref="HGNC:HGNC:7687" /db_xref="InterPro:IPR010530" /db_xref="PDB:5Z62" /db_xref="UniProtKB/Swiss-Prot:O00483" /protein_id="CAG28546.1" /translation="MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVC WDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF" BASE COUNT 67 a 58 c 56 g 62 t ORIGIN 1 atgctccgcc agatcatcgg tcaggccaag aagcatccga gcttgatccc cctctttgta 61 tttattggaa ctggagctac tggagcaaca ctgtatctct tgcgtctggc attgttcaat 121 ccagatgttt gttgggacag aaataaccca gagccctgga acaaactggg tcccaatgat 181 caatacaagt tctactcagt gaatgtggat tacagcaagc tgaagaagga acgtccagat 241 ttc //