LOCUS CR407606 789 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A052D for gene HLA-DMB, major histocompatibility complex, class II, DM beta complete cds, without stopcodon. ACCESSION CR407606 VERSION CR407606.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 789) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 789) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (07-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A052D, ORFNo 227 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A052D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_002118 we found amino acid exchange(s) at position (first base of changed triplet): 211(ser->gly) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..789 /db_xref="H-InvDB:HIT000267103_05" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A052D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>789 /codon_start=1 /gene="HLA-DMB" /db_xref="GOA:Q6LEU6" /db_xref="H-InvDB:HIT000267103_02.4" /db_xref="InterPro:IPR000353" /db_xref="InterPro:IPR003006" /db_xref="InterPro:IPR003597" /db_xref="InterPro:IPR007110" /db_xref="InterPro:IPR011162" /db_xref="InterPro:IPR013783" /db_xref="InterPro:IPR014745" /db_xref="InterPro:IPR036179" /db_xref="UniProtKB/TrEMBL:Q6LEU6" /protein_id="CAG28534.1" /translation="MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCI SFNKDLLTCWDPEENKMAPCEFGVLNGLANVLSQHLNQKDTLMQRLRNGLQNCATHTQ PFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHS SAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK VSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS" BASE COUNT 172 a 229 c 207 g 181 t ORIGIN 1 atgatcacat tcctgccgct gctgctgggg ctcagcctgg gctgcacagg agcaggtggc 61 ttcgtggccc atgtggaaag cacctgtctg ttggatgatg ctgggactcc aaaggatttc 121 acatactgca tctccttcaa caaggatctg ctgacctgct gggatccaga ggagaataag 181 atggcccctt gcgaatttgg ggtgctgaat ggcttggcga atgtcctctc acagcacctc 241 aaccaaaaag acaccctgat gcagcgcttg cgcaatgggc ttcagaattg tgccacacac 301 acccagccct tctggggatc actgaccaac aggacacggc caccatctgt gcaagtagcc 361 aaaaccactc cttttaacac gagggagcct gtgatgctgg cctgctatgt gtggggcttc 421 tatccagcag aagtgactat cacgtggagg aagaacggga agcttgtcat gcctcacagc 481 agtgcgcaca agactgccca gcccaatgga gactggacat accagaccct ctcccattta 541 gccttaaccc cctcttacgg ggacacttac acctgtgtgg tagagcacat tggggctcct 601 gagcccatcc ttcgggactg gacacctggg ctgtccccca tgcagaccct gaaggtttct 661 gtgtctgcag tgactctggg cctgggcctc atcatcttct ctcttggtgt gatcagctgg 721 cggagagctg gccactctag ttacactcct cttcctgggt ccaattattc agaaggatgg 781 cacatttcc //