LOCUS BX640846 1767 bp mRNA linear HUM 16-OCT-2008
DEFINITION Homo sapiens mRNA; cDNA DKFZp686N23273 (from clone DKFZp686N23273);
complete cds.
ACCESSION BX640846
VERSION BX640846.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1767)
AUTHORS Bloecker H., Boecher M., Mewes H.W., Weil B., Amid C., Osanger A.,
Fobo G., Han M., Wiemann S.
CONSRTM The German Human cDNA Consortium
JOURNAL Submitted (26-AUG-2003) to the INSDC. MIPS, Ingolstaedter
Landstr.1, D-85764 Neuherberg, GERMANY
COMMENT Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
Research Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
sequenced by GBF (National Research Centre for Biotechnology
Ltd., Braunschweig/Germany) within the cDNA sequencing
consortium of the German Genome Project.
This clone (DKFZp686N23273) is available at the RZPD in Berlin.
Please contact the RZPD: Ressourcenzentrum, Heubnerweg 6,
14059 Berlin-Charlottenburg, GERMANY; Email: clone@rzpd.de
Further information about the clone and the sequencing project
is available at http://mips.gsf.de/proj/cDNA/
FEATURES Location/Qualifiers
source 1..1767
/db_xref="H-InvDB:HIT000055393"
/organism="Homo sapiens"
/map="7q36.1"
/mol_type="mRNA"
/dev_stage="adult"
/clone_lib="686 (synonym: hlcc3). Vector pSport1_Sfi; host
DH10B; sites SfiIA + SfiIB"
/clone="DKFZp686N23273"
/tissue_type="human cerebellum"
/db_xref="taxon:9606"
CDS 33..368
/codon_start=1
/gene="DKFZp686N23273"
/product="hypothetical protein"
/note="vacuolar proton-ATPase subunit, N-terminus
elongated"
/db_xref="GOA:Q8NHE4"
/db_xref="H-InvDB:HIT000055393.15"
/db_xref="HGNC:HGNC:21723"
/db_xref="InterPro:IPR008389"
/db_xref="InterPro:IPR017385"
/db_xref="UniProtKB/Swiss-Prot:Q8NHE4"
/protein_id="CAE45916.1"
/translation="MLSALPGWGPAHLQRPLLGPASCLGILRPAMTAHSFALPVIIFT
TFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNET
IWYVRFLWE"
regulatory 1726..1731
/regulatory_class="polyA_signal_sequence"
polyA_site 1742
BASE COUNT 315 a 568 c 504 g 380 t
ORIGIN
1 ggatcgcttc gagtgctcga ctcctgttgc gcatgctcag cgcgctgccc ggctggggac
61 ccgcgcacct gcagcgcccg ctgctcggcc ctgcatcctg cctgggcatc ctgcgcccgg
121 ccatgacggc gcactcattc gccctcccgg tcatcatctt caccacgttc tggggcctcg
181 tcggcatcgc cgggccctgg ttcgtgccga agggacccaa ccgcggagtg atcatcacca
241 tgctggtcgc caccgccgtc tgctgttacc tcttctggct catcgccatc ctggcgcagc
301 tgaaccccct gttcgggccc cagctgaaga atgagaccat ctggtacgtg cgcttcctgt
361 gggagtgacc cgccgccccc gacccaggtg cccagctctc ggaatgactg tggctccact
421 gtccctgaca accccttcgt ccggaccctc ccccacacaa ctatgtctgg tcaccagctc
481 cctcctgctg gcacccagag acccggaccc gcagggcctg cctggttcct ggaagtcttc
541 ccagtcttcc cagccagccc gggccctggg gagccctggg cacagcagcg gccgagggga
601 tgtcctgctc caatacccgc actgctctgg agtttgccct ctttcccaag gagatgctgc
661 tggggagctg gtatgggtgg ggtctttccc tttacagacg gggcagatgc caggactcag
721 cccatcctga ggaggacacg tgtcctcatg gagagggtgc tccggcccag gcgggggagt
781 cagtgcccag tcagcagctc tgccaccatc ctgctgggaa ctgggggggc ctctattggg
841 ttataggcaa ggccttttct ctggcatgga attgttaatt ttctgacacg tctagatgtg
901 aaatttctga aaatgttgaa gcagagaaac attcacacac aaaaagcaac atagtcatgt
961 gggtccagat ggcctcagtc ctagatgttg gcaccctttg ctgtgtctcc tcagagtatc
1021 ctgttccgcc tcctgccacc tggacctccc tcagtggatg tcttccctcc cccgacccca
1081 gcctgtcagt ccgagcacag tgcaggtttg gctctgactt ggccttttgg ctgcagtggg
1141 ggtggatttc agagcctctc atggcagcat ctaagtgacc agagctggga tgagagaggg
1201 gaaggggcaa tgtgagtggc gctatgggac gggccagccc tgctcctgag ccagccccgc
1261 cctctgcccc ctggccctgg gctctgtgct agggatggtg aagaatgggg gcgtgccagc
1321 ctggcaggag tgggaagcaa cacgcagggg tcccggacct ctccagcctt gccctcacgc
1381 ttacccgagc tcccagtgtg gttagcacag agctcaccca ccttgcctgg ctcccagctg
1441 gggcctgtcc tcactggtgc tccaggggaa gaaacgacag cctcacttct gtatggactg
1501 ctgatgtggc ctgccatcct gttcagcggg cattgtcttt ggagcagcag gagaatagga
1561 tgcctctcac tcacatgcca gttcctggct ggccagctgc tcagggctca ggctggggcc
1621 tcccattgac atcctccccc tacactccct ctctgagcct ccgtcgcccc tcctgttggg
1681 taagggtgtt gagtgtgact tgtgctgaaa acctggttca tatataataa ataatggtga
1741 tgaaaagaaa aaaaaaaaaa aaaaaca
//