LOCUS       BX538291                 962 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens mRNA; cDNA DKFZp686I23148 (from clone DKFZp686I23148).
ACCESSION   BX538291
VERSION     BX538291.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 962)
  AUTHORS   Lauber J., Bahr A., Mewes H.W., Weil B., Amid C., Osanger A.,
            Fobo G., Han M., Wiemann S.
  JOURNAL   Submitted (17-JUN-2003) to the INSDC. MIPS, Ingolstaedter
            Landstr.1, D-85764 Neuherberg, GERMANY
COMMENT     Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
            Research Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
            sequenced by Qiagen (Hilden/Germany) within the cDNA sequencing
            consortium of the German Genome Project.
            This clone (DKFZp686I23148) is available at the RZPD in Berlin.
            Please contact the RZPD: Ressourcenzentrum, Heubnerweg 6,
            14059 Berlin-Charlottenburg, GERMANY; Email: clone@rzpd.de
            Further information about the clone and the sequencing project
            is available at http://mips.gsf.de/proj/cDNA/
FEATURES             Location/Qualifiers
     source          1..962
                     /db_xref="H-InvDB:HIT000055073"
                     /organism="Homo sapiens"
                     /map="17p11.2"
                     /mol_type="mRNA"
                     /dev_stage="adult"
                     /clone_lib="686 (synonym: hlcc3). Vector pSport1_Sfi; host
                     DH10B; sites SfiIA + SfiIB"
                     /clone="DKFZp686I23148"
                     /tissue_type="human colon endothel primary cell culture"
                     /db_xref="taxon:9606"
     CDS             <1..233
                     /codon_start=3
                     /gene="DKFZp686I23148"
                     /product="hypothetical protein"
                     /note="hypothetical protein"
                     /db_xref="H-InvDB:HIT000055073.15"
                     /db_xref="UniProtKB/TrEMBL:Q7Z306"
                     /protein_id="CAD98086.1"
                     /translation="FSFPLLWRATSARAWSLRRPGPGSPAHSGGVQTRENWIAYPLQS
                     AEDGVATRLQIREESASCLAAEYWSQEPAMRF"
     regulatory      909..914
                     /regulatory_class="polyA_signal_sequence"
     polyA_site      931
BASE COUNT          254 a          209 c          229 g          270 t
ORIGIN      
        1 gcttttcatt cccgttgtta tggagggcca catctgccag agcctggagt ctgcgaaggc
       61 cgggacccgg ttccccggcc cacagtgggg gtgtgcaaac ccgagagaac tggattgcgt
      121 acccactgca gagtgctgaa gacggggtag ccacgaggtt gcaaattcgt gaagaatcag
      181 catcatgttt ggcagctgag tattggagcc aggagcctgc catgaggttt tgagaacaga
      241 gtgctgtttt agagctggca gcagcatctc agcccaagag aaggttatat tcccagagga
      301 tgtcagtccc aaggaccagt agctgccatc agtttggatt ctgaaaacta actggcatca
      361 acactgggtg tagaaacatg cttgccttat gtatcagagg acatgctcag cagatccaag
      421 agatatattt ggcaactttt tctagaaaag gcacattggg tatcattcat tacattcttg
      481 agtttttttg ggtttttttt tttttttttg agacagtctt gctgtattgc ccaggctgga
      541 gtgtggtggc acaatcacag ctcattgcat cctcaatcac ccaggcctaa gcaatcctcc
      601 caccttgtag ctgggactac agctcacagc acacctggct aaaatttttt ttttgttgag
      661 acggattctc tatgttgccc aggctggtct caggctcctg ggctcagatg gtcctcctgc
      721 ctcagctttc aaaggcacag gccaagttgt agctttgtcc cttgccatca tgcccaacaa
      781 gaggttctat accttttaat gaattgactt tcataaattg gttatgttgg tgggcaagtt
      841 ctttaagctg gaaattgtaa attcctcctg aaatgttttt tcatgcagtt accatgaact
      901 aatactacaa taaaggatgg tcttgggtgt caaaaaaaaa aaaaaaaaaa aaaaaaaaaa
      961 aa
//