LOCUS BX538291 962 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens mRNA; cDNA DKFZp686I23148 (from clone DKFZp686I23148). ACCESSION BX538291 VERSION BX538291.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 962) AUTHORS Lauber J., Bahr A., Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M., Wiemann S. JOURNAL Submitted (17-JUN-2003) to the INSDC. MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY COMMENT Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de; sequenced by Qiagen (Hilden/Germany) within the cDNA sequencing consortium of the German Genome Project. This clone (DKFZp686I23148) is available at the RZPD in Berlin. Please contact the RZPD: Ressourcenzentrum, Heubnerweg 6, 14059 Berlin-Charlottenburg, GERMANY; Email: clone@rzpd.de Further information about the clone and the sequencing project is available at http://mips.gsf.de/proj/cDNA/ FEATURES Location/Qualifiers source 1..962 /db_xref="H-InvDB:HIT000055073" /organism="Homo sapiens" /map="17p11.2" /mol_type="mRNA" /dev_stage="adult" /clone_lib="686 (synonym: hlcc3). Vector pSport1_Sfi; host DH10B; sites SfiIA + SfiIB" /clone="DKFZp686I23148" /tissue_type="human colon endothel primary cell culture" /db_xref="taxon:9606" CDS <1..233 /codon_start=3 /gene="DKFZp686I23148" /product="hypothetical protein" /note="hypothetical protein" /db_xref="H-InvDB:HIT000055073.15" /db_xref="UniProtKB/TrEMBL:Q7Z306" /protein_id="CAD98086.1" /translation="FSFPLLWRATSARAWSLRRPGPGSPAHSGGVQTRENWIAYPLQS AEDGVATRLQIREESASCLAAEYWSQEPAMRF" regulatory 909..914 /regulatory_class="polyA_signal_sequence" polyA_site 931 BASE COUNT 254 a 209 c 229 g 270 t ORIGIN 1 gcttttcatt cccgttgtta tggagggcca catctgccag agcctggagt ctgcgaaggc 61 cgggacccgg ttccccggcc cacagtgggg gtgtgcaaac ccgagagaac tggattgcgt 121 acccactgca gagtgctgaa gacggggtag ccacgaggtt gcaaattcgt gaagaatcag 181 catcatgttt ggcagctgag tattggagcc aggagcctgc catgaggttt tgagaacaga 241 gtgctgtttt agagctggca gcagcatctc agcccaagag aaggttatat tcccagagga 301 tgtcagtccc aaggaccagt agctgccatc agtttggatt ctgaaaacta actggcatca 361 acactgggtg tagaaacatg cttgccttat gtatcagagg acatgctcag cagatccaag 421 agatatattt ggcaactttt tctagaaaag gcacattggg tatcattcat tacattcttg 481 agtttttttg ggtttttttt tttttttttg agacagtctt gctgtattgc ccaggctgga 541 gtgtggtggc acaatcacag ctcattgcat cctcaatcac ccaggcctaa gcaatcctcc 601 caccttgtag ctgggactac agctcacagc acacctggct aaaatttttt ttttgttgag 661 acggattctc tatgttgccc aggctggtct caggctcctg ggctcagatg gtcctcctgc 721 ctcagctttc aaaggcacag gccaagttgt agctttgtcc cttgccatca tgcccaacaa 781 gaggttctat accttttaat gaattgactt tcataaattg gttatgttgg tgggcaagtt 841 ctttaagctg gaaattgtaa attcctcctg aaatgttttt tcatgcagtt accatgaact 901 aatactacaa taaaggatgg tcttgggtgt caaaaaaaaa aaaaaaaaaa aaaaaaaaaa 961 aa //