LOCUS       BT020151                 651 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens RAB11A, member RAS oncogene family mRNA, complete cds.
ACCESSION   BT020151
VERSION     BT020151.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 651)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 651)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..651
                     /db_xref="H-InvDB:HIT000266836"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00428X1.2"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..651
                     /codon_start=1
                     /product="RAB11A, member RAS oncogene family"
                     /protein_id="AAV38953.1"
                     /translation="MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTI
                     GVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENV
                     ERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTN
                     VEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI"
BASE COUNT          209 a          125 c          149 g          168 t
ORIGIN      
        1 atgggcaccc gcgacgacga gtacgactac ctctttaaag ttgtccttat tggagattct
       61 ggtgttggaa agagtaatct cctgtctcga tttactcgaa atgagtttaa tctggaaagc
      121 aagagcacca ttggagtaga gtttgcaaca agaagcatcc aggttgatgg aaaaacaata
      181 aaggcacaga tatgggacac agcagggcaa gagcgatatc gagctataac atcagcatat
      241 tatcgtggag ctgtaggtgc cttattggtt tatgacattg ctaaacatct cacatatgaa
      301 aatgtagagc gatggctgaa agaactgaga gatcatgctg atagtaacat tgttatcatg
      361 cttgtgggca ataagagtga tctacgtcat ctcagggcag ttcctacaga tgaagcaaga
      421 gcttttgcag aaaagaatgg tttgtcattc attgaaactt cggccctaga ctctacaaat
      481 gtagaagctg cttttcagac aattttaaca gagatttacc gcattgtttc tcagaagcaa
      541 atgtcagaca gacgcgaaaa tgacatgtct ccaagcaaca atgtggttcc tattcatgtt
      601 ccaccaacca ctgaaaacaa gccaaaggtg cagtgctgtc agaacatcta g
//