LOCUS BT020151 651 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens RAB11A, member RAS oncogene family mRNA, complete cds. ACCESSION BT020151 VERSION BT020151.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 651) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 651) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..651 /db_xref="H-InvDB:HIT000266836" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00428X1.2" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..651 /codon_start=1 /product="RAB11A, member RAS oncogene family" /protein_id="AAV38953.1" /translation="MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTI GVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENV ERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTN VEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI" BASE COUNT 209 a 125 c 149 g 168 t ORIGIN 1 atgggcaccc gcgacgacga gtacgactac ctctttaaag ttgtccttat tggagattct 61 ggtgttggaa agagtaatct cctgtctcga tttactcgaa atgagtttaa tctggaaagc 121 aagagcacca ttggagtaga gtttgcaaca agaagcatcc aggttgatgg aaaaacaata 181 aaggcacaga tatgggacac agcagggcaa gagcgatatc gagctataac atcagcatat 241 tatcgtggag ctgtaggtgc cttattggtt tatgacattg ctaaacatct cacatatgaa 301 aatgtagagc gatggctgaa agaactgaga gatcatgctg atagtaacat tgttatcatg 361 cttgtgggca ataagagtga tctacgtcat ctcagggcag ttcctacaga tgaagcaaga 421 gcttttgcag aaaagaatgg tttgtcattc attgaaactt cggccctaga ctctacaaat 481 gtagaagctg cttttcagac aattttaaca gagatttacc gcattgtttc tcagaagcaa 541 atgtcagaca gacgcgaaaa tgacatgtct ccaagcaaca atgtggttcc tattcatgtt 601 ccaccaacca ctgaaaacaa gccaaaggtg cagtgctgtc agaacatcta g //