LOCUS BT020133 957 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens APEX nuclease (multifunctional DNA repair enzyme) 1 mRNA, complete cds. ACCESSION BT020133 VERSION BT020133.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 957) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 957) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..957 /db_xref="H-InvDB:HIT000266828" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00828X1.1" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..957 /note="Mutations: 956:OK" /codon_start=1 /product="APEX nuclease (multifunctional DNA repair enzyme) 1" /protein_id="AAV38935.1" /translation="MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPAL YEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSEN KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVA EFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEI DLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSK NVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL" BASE COUNT 252 a 240 c 264 g 201 t ORIGIN 1 atgccgaagc gtgggaaaaa gggagcggtg gcggaagacg gggatgagct caggacagag 61 ccagaggcca agaagagtaa gacggccgca aagaaaaatg acaaagaggc agcaggagag 121 ggcccagccc tgtatgagga ccccccagat cagaaaacct cacccagtgg caaacctgcc 181 acactcaaga tctgctcttg gaatgtggat gggcttcgag cctggattaa gaagaaagga 241 ttagattggg taaaggaaga agccccagat atactgtgcc ttcaagagac caaatgttca 301 gagaacaaac taccagctga acttcaggag ctgcctggac tctctcatca atactggtca 361 gctccttcgg acaaggaagg gtacagtggc gtgggcctgc tttcccgcca gtgcccactc 421 aaagtttctt acggcatagg cgatgaggag catgatcagg aaggccgggt gattgtggct 481 gaatttgact cgtttgtgct ggtaacagca tatgtaccta atgcaggccg aggtctggta 541 cgactggagt accggcagcg ctgggatgaa gcctttcgca agttcctgaa gggcctggct 601 tcccgaaagc cccttgtgct gtgtggagac ctcaatgtgg cacatgaaga aattgacctt 661 cgcaacccca aggggaacaa aaagaatgct ggcttcacgc cacaagagcg ccaaggcttc 721 ggggaattac tgcaggctgt gccactggct gacagcttta ggcacctcta ccccaacaca 781 ccctatgcct acaccttttg gacttatatg atgaatgctc gatccaagaa tgttggttgg 841 cgccttgatt actttttgtt gtcccactct ctgttacctg cattgtgtga cagcaagatc 901 cgttccaagg ccctcggcag tgatcactgt cctatcaccc tatacctagc actgtag //