LOCUS       BT020133                 957 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens APEX nuclease (multifunctional DNA repair enzyme) 1
            mRNA, complete cds.
ACCESSION   BT020133
VERSION     BT020133.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 957)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 957)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..957
                     /db_xref="H-InvDB:HIT000266828"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00828X1.1"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..957
                     /note="Mutations: 956:OK"
                     /codon_start=1
                     /product="APEX nuclease (multifunctional DNA repair
                     enzyme) 1"
                     /protein_id="AAV38935.1"
                     /translation="MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPAL
                     YEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSEN
                     KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVA
                     EFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEI
                     DLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSK
                     NVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL"
BASE COUNT          252 a          240 c          264 g          201 t
ORIGIN      
        1 atgccgaagc gtgggaaaaa gggagcggtg gcggaagacg gggatgagct caggacagag
       61 ccagaggcca agaagagtaa gacggccgca aagaaaaatg acaaagaggc agcaggagag
      121 ggcccagccc tgtatgagga ccccccagat cagaaaacct cacccagtgg caaacctgcc
      181 acactcaaga tctgctcttg gaatgtggat gggcttcgag cctggattaa gaagaaagga
      241 ttagattggg taaaggaaga agccccagat atactgtgcc ttcaagagac caaatgttca
      301 gagaacaaac taccagctga acttcaggag ctgcctggac tctctcatca atactggtca
      361 gctccttcgg acaaggaagg gtacagtggc gtgggcctgc tttcccgcca gtgcccactc
      421 aaagtttctt acggcatagg cgatgaggag catgatcagg aaggccgggt gattgtggct
      481 gaatttgact cgtttgtgct ggtaacagca tatgtaccta atgcaggccg aggtctggta
      541 cgactggagt accggcagcg ctgggatgaa gcctttcgca agttcctgaa gggcctggct
      601 tcccgaaagc cccttgtgct gtgtggagac ctcaatgtgg cacatgaaga aattgacctt
      661 cgcaacccca aggggaacaa aaagaatgct ggcttcacgc cacaagagcg ccaaggcttc
      721 ggggaattac tgcaggctgt gccactggct gacagcttta ggcacctcta ccccaacaca
      781 ccctatgcct acaccttttg gacttatatg atgaatgctc gatccaagaa tgttggttgg
      841 cgccttgatt actttttgtt gtcccactct ctgttacctg cattgtgtga cagcaagatc
      901 cgttccaagg ccctcggcag tgatcactgt cctatcaccc tatacctagc actgtag
//