LOCUS       BT020072                 576 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens programmed cell death 6 mRNA, complete cds.
ACCESSION   BT020072
VERSION     BT020072.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 576)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 576)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..576
                     /db_xref="H-InvDB:HIT000266805"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01558X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..576
                     /note="Mutations: 438:OK;575:OK"
                     /codon_start=1
                     /product="programmed cell death 6"
                     /protein_id="AAV38875.1"
                     /translation="MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVIS
                     DTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTY
                     DRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQR
                     LTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV"
BASE COUNT          126 a          161 c          168 g          121 t
ORIGIN      
        1 atggccgcct actcttaccg ccccggccct ggggccggcc ctgggcctgc tgcaggcgcg
       61 gcgctgccgg accagagctt cctgtggaac gttttccaga gggtcgataa agacaggagt
      121 ggagtgatat cagacaccga gcttcagcaa gctctctcca acggcacgtg gactcccttt
      181 aatccagtga ctgtcaggtc gatcatatcc atgtttgacc gtgagaacaa ggccggcgtg
      241 aacttcagcg agttcacggg tgtgtggaag tacatcacgg actggcagaa cgtcttccgc
      301 acgtacgacc gggacaactc cgggatgatc gataagaacg agctgaagca ggccctctca
      361 ggtttcggct accggctctc tgaccagttc cacgacatcc tcattcgaaa gtttgacagg
      421 cagggacggg ggcagatcgc cttcgacgac ttcatccagg gctgcatcgt cctgcagagg
      481 ttgacggata tattcagacg ttacgacacg gatcaggacg gctggattca ggtgtcgtac
      541 gaacagtacc tgtccatggt cttcagtatc gtatag
//