LOCUS BT020072 576 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens programmed cell death 6 mRNA, complete cds. ACCESSION BT020072 VERSION BT020072.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 576) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 576) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..576 /db_xref="H-InvDB:HIT000266805" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01558X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..576 /note="Mutations: 438:OK;575:OK" /codon_start=1 /product="programmed cell death 6" /protein_id="AAV38875.1" /translation="MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVIS DTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTY DRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQR LTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV" BASE COUNT 126 a 161 c 168 g 121 t ORIGIN 1 atggccgcct actcttaccg ccccggccct ggggccggcc ctgggcctgc tgcaggcgcg 61 gcgctgccgg accagagctt cctgtggaac gttttccaga gggtcgataa agacaggagt 121 ggagtgatat cagacaccga gcttcagcaa gctctctcca acggcacgtg gactcccttt 181 aatccagtga ctgtcaggtc gatcatatcc atgtttgacc gtgagaacaa ggccggcgtg 241 aacttcagcg agttcacggg tgtgtggaag tacatcacgg actggcagaa cgtcttccgc 301 acgtacgacc gggacaactc cgggatgatc gataagaacg agctgaagca ggccctctca 361 ggtttcggct accggctctc tgaccagttc cacgacatcc tcattcgaaa gtttgacagg 421 cagggacggg ggcagatcgc cttcgacgac ttcatccagg gctgcatcgt cctgcagagg 481 ttgacggata tattcagacg ttacgacacg gatcaggacg gctggattca ggtgtcgtac 541 gaacagtacc tgtccatggt cttcagtatc gtatag //