LOCUS       BT020065                 915 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens hairy/enhancer-of-split related with YRPW motif 1
            mRNA, complete cds.
ACCESSION   BT020065
VERSION     BT020065.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 915)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 915)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..915
                     /db_xref="H-InvDB:HIT000266802"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01554X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..915
                     /note="Mutations: 709:F->L;755:L->P"
                     /codon_start=1
                     /product="hairy/enhancer-of-split related with YRPW motif
                     1"
                     /protein_id="AAV38868.1"
                     /translation="MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTS
                     SQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLK
                     MLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNN
                     YASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGR
                     LGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSP
                     NALSPSAPTQAANLGKPYRPWGTEIGAF"
BASE COUNT          196 a          283 c          258 g          178 t
ORIGIN      
        1 atgaagcgag ctcaccccga gtacagctcc tcggacagcg agctggacga gaccatcgag
       61 gtggagaagg agagtgcgga cgagaatgga aacttgagtt cggctctagg ttccatgtcc
      121 ccaactacat cttcccagat tttggccaga aaaagacgga gaggaataat tgagaagcgc
      181 cgacgagacc ggatcaataa cagtttgtct gagctgagaa ggctggtacc cagtgctttt
      241 gagaagcagg gatctgctaa gctagaaaaa gccgagatcc tgcagatgac cgtggatcac
      301 ctgaaaatgc tgcatacggc aggagggaaa ggttactttg acgcgcacgc ccttgctatg
      361 gactatcgga gtttgggatt tcgggaatgc ctggcagaag ttgcgcgtta tctgagcatc
      421 attgaaggac tagatgcctc tgacccgctt cgagttcgac tggtttcgca tctcaacaac
      481 tacgcttccc agcgggaagc cgcgagcggc gcccacgcgg gcctcggaca cattccctgg
      541 gggaccgtct tcggacatca cccgcacatc gcgcacccgc tgttgctgcc ccagaacggc
      601 cacgggaacg cgggcaccac ggcctcaccc acggaaccgc accaccaggg caggctgggc
      661 tcggcacatc cggaggcgcc tgctttgcga gcgcccccta gcggcagcct cggaccggtg
      721 ctccctgtgg tcacctccgc ctccaaactg tcgccgcctc tgctctcctc agtggcctcc
      781 ctgtcggcct tccccttctc tttcggctcc ttccacttac tgtctcccaa tgcactgagc
      841 ccttcagcac ccacgcaggc tgcaaacctt ggcaagccct atagaccttg ggggacggag
      901 atcggagctt tttag
//