LOCUS BT020065 915 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens hairy/enhancer-of-split related with YRPW motif 1 mRNA, complete cds. ACCESSION BT020065 VERSION BT020065.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 915) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 915) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..915 /db_xref="H-InvDB:HIT000266802" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01554X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..915 /note="Mutations: 709:F->L;755:L->P" /codon_start=1 /product="hairy/enhancer-of-split related with YRPW motif 1" /protein_id="AAV38868.1" /translation="MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTS SQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLK MLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNN YASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGR LGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSP NALSPSAPTQAANLGKPYRPWGTEIGAF" BASE COUNT 196 a 283 c 258 g 178 t ORIGIN 1 atgaagcgag ctcaccccga gtacagctcc tcggacagcg agctggacga gaccatcgag 61 gtggagaagg agagtgcgga cgagaatgga aacttgagtt cggctctagg ttccatgtcc 121 ccaactacat cttcccagat tttggccaga aaaagacgga gaggaataat tgagaagcgc 181 cgacgagacc ggatcaataa cagtttgtct gagctgagaa ggctggtacc cagtgctttt 241 gagaagcagg gatctgctaa gctagaaaaa gccgagatcc tgcagatgac cgtggatcac 301 ctgaaaatgc tgcatacggc aggagggaaa ggttactttg acgcgcacgc ccttgctatg 361 gactatcgga gtttgggatt tcgggaatgc ctggcagaag ttgcgcgtta tctgagcatc 421 attgaaggac tagatgcctc tgacccgctt cgagttcgac tggtttcgca tctcaacaac 481 tacgcttccc agcgggaagc cgcgagcggc gcccacgcgg gcctcggaca cattccctgg 541 gggaccgtct tcggacatca cccgcacatc gcgcacccgc tgttgctgcc ccagaacggc 601 cacgggaacg cgggcaccac ggcctcaccc acggaaccgc accaccaggg caggctgggc 661 tcggcacatc cggaggcgcc tgctttgcga gcgcccccta gcggcagcct cggaccggtg 721 ctccctgtgg tcacctccgc ctccaaactg tcgccgcctc tgctctcctc agtggcctcc 781 ctgtcggcct tccccttctc tttcggctcc ttccacttac tgtctcccaa tgcactgagc 841 ccttcagcac ccacgcaggc tgcaaacctt ggcaagccct atagaccttg ggggacggag 901 atcggagctt tttag //